CAZyme Information: MGYG000003064_01412

Basic Information

• Species: Bacteroides graminisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides graminisolvens
• CAZyme ID: MGYG000003064_01412
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572	MGYG000003064_4|CGC3	62559.29	5.1102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003064	3410784	MAG	United States	North America

• Gene Location: Start: 252942; End: 254660 Strand: -

Full Sequence      

MNNLKLLSIVVCFLGISLFSCSSDDSKVEAELIVAKESLSFGNGAEMQKLAIKSNVDWQM
SSSESWCVLSASSGKPGTHQIEVNVAANTTNDTRQAVVTILAGSITKAITVTQAKTPLLI
VKQSAYNVTAQGGQITVEMQVTDPHTVKINNDWITQVSSRAVSSVSEVFTIQANAGILSR
TGTITFTMNGLTETVTIVQEAADAHIPADQTGMSSDAKTLAAKIKLGWNLGNTMEVPFTS
GGETGWGNEKTTEALIKAVKAAGFNAIRIPCAWDSYIEDPSNYTIKASWLARVKEVVDYC
VSNDVYAILNIHWDGGWLETNPTYAKQEEVNKKQAALWKQIAVQFRNYDEHLLFAGTNEV
HVENVYTEPTTENNTVQQSYNQTFVDAVRATGGKNAYRNLIVQTYNTNIGYGVKFMNMPT
DNVANRMFVEVHYYDPYEFTLKEEGGLNYWGEPYKQYGAVGSWGQEADLDAAFASVKTNF
VDKGYPAILGEFGAIKRATLTGDALTHHLESRAYYVKQVVSTAKKYGMVPFYWDNGPSGN
NAMGIFNRATGAVSDQQILNGLVEGSAVNYPF

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	243	536	1.4e-104	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	8.65e-55	243	539	16	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.52e-21	227	538	54	362	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	4.87e-20	31	114	1	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
cd14948	BACON	1.44e-12	119	200	2	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam19190	BACON_2	3.26e-12	31	114	1	89	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ18612.1	7.30e-163	9	566	4	551
QIK55671.1	1.56e-159	117	564	34	487
QIK61079.1	4.06e-157	117	564	34	487
ALJ60577.1	3.25e-156	2	567	3	595
SCD22090.1	8.43e-149	13	572	8	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OYC_A	8.75e-116	209	566	37	393	GH5endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYC_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107]
6HA9_A	6.96e-115	209	566	37	393	Structureof an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HA9_B Structure of an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_A Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_B Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107]
3ZMR_A	3.42e-96	130	565	21	465	Bacteroidesovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus],3ZMR_B Bacteroides ovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus]
2JEP_A	1.35e-84	197	565	15	393	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
4W8A_A	3.01e-75	216	572	2	378	Crystalstructure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W8B_A Crystal structure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in complex with XXLG [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT7	3.39e-97	3	565	15	500	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
O08342	2.60e-82	214	565	37	398	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P28623	5.51e-62	217	565	43	371	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P28621	1.03e-59	217	566	42	374	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P10477	3.87e-59	220	568	60	387	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.140539	0.859071	0.000078	0.000070	0.000058

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003064_01412.