CAZyme Information: MGYG000003064_00389

Basic Information

• Species: Bacteroides graminisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides graminisolvens
• CAZyme ID: MGYG000003064_00389
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000003064_1|CGC11	36083.17	8.3361

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003064	3410784	MAG	United States	North America

• Gene Location: Start: 499148; End: 500110 Strand: -

Full Sequence      

MMSMLKRIVLSIFMLTSVSNSILAQQQDTLVVSRDGTGKYRTIQEAVEAVRAFMDYTVTI
YIKNGLYKEKLVIPSWLKNVQIVGESAEGTIITYDDHANINKMGTFRTYTVKVEGSGITF
KNLTIENNAAQLGQAVALHTEGDKLIFIGCRFLGNQDTIYTGAEGTRLLFSHCYIEGTTD
FIFGPSTALFEYCTIHSKRNSYITAASTPKDVEYGYVFKNCKLAAADGVDKVYLGRPWRP
YAATAFINCEMGKHICAPGWENWRNPENEKTARYAEFDNRGEGSSLAGRVNWSHKLTKKE
ALKYTIENIFKNCSDWYPFK

Enzyme Prediction     

No EC number prediction in MGYG000003064_00389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	311	6.5e-102	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	9.23e-76	31	308	3	293	Pectinesterase.
PLN02773	PLN02773	4.48e-73	30	301	7	287	pectinesterase
PLN02432	PLN02432	7.97e-66	17	301	6	277	putative pectinesterase
PLN02682	PLN02682	8.66e-65	29	318	70	368	pectinesterase family protein
COG4677	PemB	8.63e-64	17	311	70	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT41964.1	2.67e-174	25	320	27	322
CAW41305.1	4.41e-173	25	320	27	322
ALJ43642.1	4.41e-173	25	320	27	322
CBC06956.1	4.41e-173	25	320	27	322
QUT69789.1	4.41e-173	25	320	27	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.92e-42	30	292	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.40e-41	31	314	6	302	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	2.28e-37	30	289	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.22e-36	30	289	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.28e-29	31	318	7	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.69e-54	32	301	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.07e-52	29	308	272	565	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q9FM79	4.00e-52	30	300	82	362	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
O49298	6.74e-52	30	308	251	535	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q42608	4.68e-51	29	308	259	552	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000283	0.998985	0.000223	0.000171	0.000162	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003064_00389.