CAZyme Information: MGYG000003064_00174

Basic Information

• Species: Bacteroides graminisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides graminisolvens
• CAZyme ID: MGYG000003064_00174
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
791	MGYG000003064_1|CGC6	90185.03	6.6216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003064	3410784	MAG	United States	North America

• Gene Location: Start: 254792; End: 257167 Strand: -

Full Sequence      

MNKKSILVSVFVLICAPSFAQDKLYADEFPLGDVTLLDGPLKKACDLNIKTLLQYDCDRL
LAPYRKEAGLAPKGKTYPNWDGLDGHVGGHYLTAMAINAATGHEECRKRMEYMIAEIAEC
AEANKKNHPEWGNGYMGGFPHSDKLWSTFKTGNFSTYFGSWAPFYNLHKMYAGLRDAWLY
CGNEQAKQLFLEFSDWAVNITSSLSDEQMEQMLGNEHGGMNEVLADAYAITHDKKYIDCA
KRFSHKKLFTPMSQRQDCLDNMHANTQVPKAIGFERIAELTGDETYHAAGSFFWDIVTGE
RSLAFGGNSRREHFPSKEACTDFINDIDGPESCNTNNMLKLTEDLHRRNPEARYADYYEL
ATFNHILSTQHSEHGGYVYFTPARPRHYRNYSAPNEAMWCCVGTGMENHGKYGQFIYTSR
HDALYVNLFTASELNWKAKGVVLRQETAFPYDETSKITIAKGKGQFKLLVRYPGWVKPGD
FKVSVNGKPVTLITGPSSYVCIDRQWKKGDVVDVTFPMHNSIKYLPNTPQYIAIMHGPVL
LGMKTGTEDLAHLVADDSRFGQYAGGKKLPVDKAPILINNDIESIATQLTPIHGKPLHFR
LSTRMENAIDNELQPFFEIHDSRYMMYWLALTEKNYKEYIAQLAKEEEERQLLEARTIDK
VQPGEQQPETDHKMETDNSFTGNTNDVFYRDARDGHYFSYLMQTGGKTDLDLQLKYWGVG
EWKTHEFDIFIDDVLVKSVNNTGKYRISEFKTETYDIPSSVLKDKTQVRIKFVARPGKQI
GEIYGVRLLEK

Enzyme Prediction     

No EC number prediction in MGYG000003064_00174.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	33	541	4.8e-193	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.01e-167	33	541	1	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.86e-105	34	541	12	500	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.53e-32	546	628	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68311.1	0.0	9	791	6	790
ADE81022.1	0.0	10	789	2	784
QVJ82255.1	0.0	10	789	2	784
QCD37014.1	0.0	20	789	27	799
AHW58814.1	0.0	6	789	9	792

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.84e-199	20	703	19	721	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.30e-191	20	703	19	721	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	2.51e-26	164	540	142	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.69e-22	277	540	279	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.33e-21	277	540	279	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000835	0.919281	0.079057	0.000315	0.000252	0.000229

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003064_00174.