CAZyme Information: MGYG000003063_02459

Basic Information

• Species: Eisenbergiella sp900544445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900544445
• CAZyme ID: MGYG000003063_02459
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676	MGYG000003063_66|CGC1	71271.66	4.1231

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003063	3890464	MAG	United States	North America

• Gene Location: Start: 8075; End: 10105 Strand: +

Full Sequence      

MTKRRRHGRHRRRRTDWVTIAVPAGAAILVIAVVVAVILTLRGCGGTAGAVSGQAGAQET
DADAQQVGTDVQQVDADVQQIGAGAQSGENGTGAASESPADETGSELETADSGETQEESA
VTSTVAAEVGSMDDEEDPQGGANAAGTGGGASVDLNAAAKPEGETDEVTLGIDVSKYQGS
IDWEQVAQSGVEFAMIRVGYRTKVTGIIYEDPGARYNLQEAAKNGLLVGAYFFSSAVTEE
EAREEAAWVADFISRYPITYPVAYNCEDFQSPDSRQYGLGAEERTTIACAFLDTISAAGY
TPMFYASRNEMEGNAQWNMDTLGSRYRVWVSQYPERPYPETPSSTYSGTHAMWQYTSQGT
VAGIRGSVDVNLAYFGYSQAAEAKDQTPVEEVAANPELGINFTEVNDTVTAKELTNLRTL
PTTLDSEVVYQLPNGETVQRTGIGSNGWDRVIYNGQKLYAVHNFLTTDLSGSASGSGEGG
NAADGASQSGGAADGSSGEAAGSGSAQADDGTSESAGMVFRDVSEAVTARDQVNLRDQPS
TVTGNVVGTLSYGEAVVRTGISDTGWSRLEVNGQVVYASSRLLATSMDYKEQEKITDENP
EAGMHFTAASGIMMAKSGQTNLRTLPTTNAPSQVVAQLTGDATAERIAEDKDRGWTKLIY
NGQTVYAVSSYLTQVG

Enzyme Prediction     

No EC number prediction in MGYG000003063_02459.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	172	364	2e-44	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.81e-58	171	374	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	5.95e-27	171	373	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	3.53e-24	172	364	1	180	Glycosyl hydrolases family 25.
cd06524	GH25_YegX-like	2.05e-21	170	372	1	191	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
COG3757	Acm	1.17e-18	171	371	65	251	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK89713.1	4.96e-136	134	584	52	482
ACR77025.1	9.89e-136	134	584	52	482
CUH92515.1	6.19e-133	160	583	93	485
CBK93417.1	1.96e-132	134	584	52	482
ACR73526.1	3.97e-126	135	584	86	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRT_A	5.64e-16	171	465	22	283	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRU_A	2.93e-14	171	371	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
1JFX_A	1.69e-09	171	371	7	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
2WAG_A	2.83e-07	171	374	18	207	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
5A6S_A	2.34e-06	173	369	26	197	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	9.24e-14	162	465	2	272	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
Q8X7H0	1.36e-08	171	372	69	253	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	2.22e-08	171	371	84	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P76421	3.27e-08	171	372	69	253	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	5.87e-08	171	372	69	253	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.970946	0.023658	0.004259	0.000124	0.000171	0.000870

TMHMM  Annotations     

start	end
17	39