CAZyme Information: MGYG000003058_00178

Basic Information

• Species: UBA7001 sp900553685
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UBA7001; UBA7001 sp900553685
• CAZyme ID: MGYG000003058_00178
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		48725.09	9.4941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003058	1822100	MAG	United States	North America

• Gene Location: Start: 196316; End: 197569 Strand: +

Full Sequence      

MKIIEEVLKIIDFFSIACMIYYVVIGLCSLRKSKNETDSKNFKKFACIIPARNEELVIEN
LLESLKKQNYPKEFYDIFVIPNNCTDNTEMISKQQKVKIINCENVRTNSKGDVLRHVFKV
LKNEDYEAYIIFDADNVVHPNFIKKMNNILNKGYRLAQGYRDSKNPSDTWISSTSSLHYM
VQNYFVNKARMNISQSSFINGTGFMISKELIEEKGYNSLTMTEDIELTVKCALDKEKIAF
VEEAITYDEQPIKFSESWKQRKRWSVGTIQCLKMYSKSLKNDIIKNKNFGALDSLLFLFA
PYMQLLTTAIFLLHILTNVVETLEINFISKIFFSIMWYILSILMSILLVKINKKDIKRYL
KGIFTLPLFYFSWIPINIIACFKKNLKWEKIEHTRTISFNNILSLSYLSNGVKHEKG

Enzyme Prediction     

No EC number prediction in MGYG000003058_00178.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	45	267	4e-33	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	1.30e-61	48	227	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	4.73e-39	10	394	21	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.24e-31	48	224	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	5.15e-26	45	265	4	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd04192	GT_2_like_e	9.63e-17	48	264	2	226	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADO38773.1	1.79e-103	20	402	21	410
ARD65366.1	1.79e-103	20	402	21	410
ALU13522.1	5.06e-103	20	402	21	410
QCT71577.1	5.06e-103	20	402	21	410
AWW28570.1	2.20e-97	48	403	1	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TZE_C	6.55e-07	44	144	2	102	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	8.97e-07	44	144	2	102	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.29e-16	38	392	44	412	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8YMK0	7.15e-13	48	302	111	366	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	3.00e-12	25	302	87	366	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
P74165	5.24e-10	42	270	107	338	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q84W06	6.65e-07	39	288	88	347	Probable glucomannan 4-beta-mannosyltransferase 14 OS=Arabidopsis thaliana OX=3702 GN=CSLA14 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000012	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
10	30
295	317
327	349
362	381