CAZyme Information: MGYG000003043_00956

Basic Information

• Species: Collinsella sp900541145
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900541145
• CAZyme ID: MGYG000003043_00956
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	MGYG000003043_54|CGC1	32199.76	4.2516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003043	1948094	MAG	Netherlands	Europe

• Gene Location: Start: 11080; End: 11946 Strand: -

Full Sequence      

MGAGIVLEPGENAREAEYRAAHNELVASAWATKIAHEVDPENRVGCMLAAGSYYPYSCRP
EDVRAAQVKNQEDLFFVDVQARGRYPGYALKMLEREGIDVGMTAEDERILAENTVDFISF
SYYSSRCTAGDPDSVGGVAEGNAFAGVENPYVRTSDWGWVIDPLGFRITINDLWDRYQKP
LFVVENGLGAYDEVLPDGTIEDDYRIAYLREHIEAMRDAIEQDGVEMLGYTTWGPIDLVS
AGSGEMEKRYGFIYVDRDSLGNGTLERRRKKSFYWYQQAIATNGGDLG

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	8	284	5.3e-70	0.5757575757575758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09593	arb	3.06e-162	1	287	192	477	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	1.39e-156	2	288	191	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	1.84e-122	3	287	193	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	6.04e-120	9	284	184	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK15014	PRK15014	3.17e-104	3	287	195	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA32972.1	3.69e-214	1	288	189	476
QWT17213.1	2.94e-156	1	288	189	475
AZH68819.1	5.74e-154	1	287	189	475
ATP54514.1	1.77e-150	1	287	189	475
AEB07701.1	1.31e-147	1	287	189	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.60e-115	2	287	186	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	3.00e-96	3	287	197	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	7.04e-92	3	287	196	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.99e-91	3	287	196	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	5.00e-89	3	287	196	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	1.34e-125	2	287	191	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	6.73e-117	2	287	186	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	5.34e-107	2	287	183	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46130	5.99e-100	1	287	184	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P11988	3.10e-99	2	287	183	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999379	0.000632	0.000012	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003043_00956.