CAZyme Information: MGYG000003042_01730

Basic Information

• Species: Gemmiger sp900545545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900545545
• CAZyme ID: MGYG000003042_01730
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		33377.81	4.9936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003042	2618954	MAG	Netherlands	Europe

• Gene Location: Start: 66847; End: 67728 Strand: +

Full Sequence      

MAQTWASGTTLDSCRWEYGKMWECPDFFPLEGKQLLLVIPQEMEASPDGEFHPGFGTVAL
LGRYDKATARFTRETVQPIDYGTDFYAPQTVLTPDGRRVMVAWMENWATVNEAPRRHPWF
GQMTMPRELFLREGRLCQRPVRELETLWQDTLTRHEVLDGDAVYEGVAGRRLDLTVTLDA
AASPDCRRFTLSFAQDARHRTTVEWSPVYNELLFDRSDCGTRRDIPHLRRLKAAPKDGKL
TLRLILDGDCLELFVNDGERTLTALLDTPAEADGISLHSEGAVTLELLQHTLH

Enzyme Prediction     

No EC number prediction in MGYG000003042_01730.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	5	140	1.9e-32	0.43686006825938567

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1621	SacC	2.00e-53	18	285	214	476	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
TIGR01322	scrB_fam	3.29e-44	19	264	203	440	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd08996	GH32_FFase	1.64e-39	16	131	175	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	1.46e-37	7	258	176	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	2.16e-33	17	140	182	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB28040.1	3.91e-85	5	293	206	490
AXA82442.1	2.19e-84	5	292	206	489
ATL90320.1	4.37e-84	5	293	206	490
CBK98452.1	6.89e-83	5	292	206	489
QIA44202.1	1.37e-82	5	293	206	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	6.34e-26	21	290	214	482	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	2.76e-22	5	259	216	452	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	2.76e-22	5	259	216	452	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
3PIG_A	5.12e-18	12	287	213	519	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
6NUM_A	1.11e-15	21	293	233	510	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5EZZ8	1.36e-31	17	278	277	522	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=cscA PE=3 SV=1
Q9KLT6	2.60e-31	17	278	277	522	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=VC_A0655 PE=3 SV=1
P16553	3.56e-31	21	279	212	460	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
Q56660	4.83e-31	18	278	278	522	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae OX=666 PE=3 SV=1
Q05936	8.99e-28	17	284	217	480	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003042_01730.