CAZyme Information: MGYG000003035_00492

Basic Information

• Species: CAG-485 sp900542185
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900542185
• CAZyme ID: MGYG000003035_00492
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686	MGYG000003035_6|CGC1	77571.77	6.021

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003035	3548444	MAG	Netherlands	Europe

• Gene Location: Start: 5022; End: 7082 Strand: -

Full Sequence      

MRLVRNLSIVLVLGMTVGQSYAHKPAGTVVTVTDAPAPGINVSYQGFRQPLQNAPFIKLP
VGKVQPSGWLRRYLELQRDGLNGQLGSISAWLDKKDNQWLSDTGSHGWEEVPYWLRGYSS
LAYILDDEDMKKEAQVWFDAVLNNIKPDGFLGPRNREGDNPEVWAQMVMLWALQTYYEAT
GNPRVLDAMTGYFKWELNQPDERFLKGLWEQKRGGDNMWNVLWLYNRTGDASILPLVDKL
HRNTSDWTRKGTLPNWHGVNVAQGFREPATYFMYTGNPKMRQATYDAFMEMRKRYGRMPG
GMYAADENAREGYFDPRNGAETCAVVEQMASDELLLRFTGDPFWADHCENVAFNTFPAAM
TEDMKALRYITSANMAVSDEKLHGPSIDNNLRGMLSMSPFSSRCCQHNHGMGWPYFAEHL
VMATSDNGLALTLYAANTTEAKAGRDGTSVRLVEETQYPFDGLVSVTVNPEKSVEFPLYI
RIPAWAIGATAKVNGKKIDVADCAGRYLCLSRKWKKGDKVEVNFPMNIRSTVWEENKNSV
SVNYGPLTLSLKIDEDREAHDSRDKAFVQDDSHWQEGVDASKWPSYVLKPKSEWNYALLT
DSRNNPVDLQVIECAWPADDFPFSPDKCPLRFTAKGVKIPSWSYDATGMTDELPDRFAPR
DTQEVTLPLIPMGAARLRISAFPTAR

Enzyme Prediction     

No EC number prediction in MGYG000003035_00492.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	274	548	1.8e-37	0.517175572519084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	9.44e-101	30	550	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.32e-32	148	560	105	511	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASY33458.1	1.19e-155	35	685	37	663
QNF41507.1	6.87e-155	44	683	38	653
BCJ47054.1	4.84e-154	35	684	25	646
APS23119.1	3.17e-153	44	685	44	667
QXQ95199.1	6.12e-153	50	685	50	667

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	7.57e-28	110	552	78	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.26e-25	110	552	78	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	6.32e-21	177	552	252	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6EX6_A	6.47e-15	132	557	89	552	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
6YQH_AAA	1.10e-12	319	550	335	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000320	0.998895	0.000233	0.000205	0.000170	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003035_00492.