CAZyme Information: MGYG000003019_01051

Basic Information

• Species: Alistipes sp900553175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900553175
• CAZyme ID: MGYG000003019_01051
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793	MGYG000003019_32|CGC1	88506.22	5.7062

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003019	1454145	MAG	China	Asia

• Gene Location: Start: 3407; End: 5788 Strand: -

Full Sequence      

MKTGKYLLTLWAVTAALAAVAGAWRPSEAEGALRRGRWPAAWIAAPEAGERTWGVYHFRK
TFDLDEVPERFVVHVSADSRYKLYVNGRFVSLGPSAGDVLNWSFETVDLAPYLRPGSNTL
AAVVWNFAGKRPLAQMSTGRCAFLLQGATEAERAVDTDASWRCIRNDAYAPYEQPVLGYY
AAGACERLSAASYPWGWEQPAFDDAGWPCAVPLMRAALKGTIDYPGWQLVPAPVRPVEMT
PVRMPRLRTCCGAEVPAAFPAEASPFTVPANSHAELLIDNEALMTGYPSLRFSGGRGASI
EIGYAESLFDRPEVGVKGDRDAVEGKLFIGYADRIEADGGRGREFMPLWWRTWRYLRLRI
ETASEPLVLEDLSAVASMYPFRRESRFSAPGFPDAETILETGWRTARLCANETYMDCPYY
EQLQYFGDTRIQAMITLYNTRNDEMVRSALEHGRRSIVSDGITASRYPSSLHQFIPSFSL
WWICMAHDYWRYRGDEEFLRGLLPGTRSVLAWFERYLKPDGSLGRIPFWFFMDWSSADYG
MPVREEEGNSAVQDLQYVLALEAAAGMERAFGLVPMAEHYEALLDGIRSSFADKYWDAER
GLFADTHDHRAYSQHANALAILAGMVPADEAPALFDRLSDDGSLLPCTIYFRYYLHQAMK
AAGRGDRFSEGLQPWRDQLALHLTTWAEQPEPSRSDCHAWGSSPNIEFFRIVLGIDSDAP
GFRRVRIAPSLGSLRKASGAIPHPAGEIAVAYERSGKGRLKARIELPEGIPGVFVWNGRE
YPLAGGANVVVAP

Enzyme Prediction     

No EC number prediction in MGYG000003019_01051.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	274	771	6.9e-112	0.9761904761904762
CBM67	40	213	1.5e-46	0.9488636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.31e-19	393	633	11	245	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	1.35e-09	479	609	86	224	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	2.78e-08	479	646	341	513	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam08531	Bac_rhamnosid_N	5.19e-08	68	241	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	5.63e-06	714	769	1	56	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47620.1	0.0	24	790	29	804
AST54236.1	0.0	33	790	35	802
QKH98192.1	0.0	33	790	35	802
QUT94468.1	0.0	33	790	35	802
QUT22158.1	0.0	33	790	35	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	8.95e-42	351	770	503	935	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	2.20e-10	31	775	139	877	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.396469	0.564622	0.036949	0.000726	0.000443	0.000796

TMHMM  Annotations     

start	end
7	24