CAZyme Information: MGYG000003019_00066

Basic Information

• Species: Alistipes sp900553175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900553175
• CAZyme ID: MGYG000003019_00066
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	MGYG000003019_1|CGC3	37881.53	9.4379

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003019	1454145	MAG	China	Asia

• Gene Location: Start: 83164; End: 84180 Strand: +

Full Sequence      

MTRTAIVILNWNGAEHLRRYLPSVVAAAPGGVRVVVADNGSTDGSAQVVRDGFPTVEWLA
LDRNYGFAGGYNRALRQIAADVYVLLNSDVETPAGWLAPLLECLERNPGVAAVAPKLLAD
ADRRHFEYAGASGGYIDFLGYPFCRGRMLRTVERDCGQYDDERDVFWVTGAAFCCRAGVF
HALGGFDETFFAHMEEIDLCWRMQLAGYWVRIVPQSVVYHLGGGTLSTDSSRKVFFNHRN
NLAMLYKCAAPGQRFVVALVRPGLDLLAALSYLVQGRTDSFRAVFRAWRDFLKWHPALKA
RRRDVQATRVPGVRLPVYRGSLLVRYLFGRRTFGRMME

Enzyme Prediction     

No EC number prediction in MGYG000003019_00066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	114	1.7e-19	0.6647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	1.69e-52	1	303	2	302	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	4.50e-51	6	222	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	7.34e-16	6	130	1	128	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	2.24e-15	6	138	2	137	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02522	GT_2_like_a	1.05e-13	6	212	3	178	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63650.1	6.72e-188	6	338	6	338
BBL05647.1	1.02e-184	1	337	1	337
BBL07919.1	3.40e-183	6	337	6	337
BBL10710.1	3.40e-183	6	337	6	337
BBK99894.1	1.96e-182	6	337	6	337

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	7.25e-26	6	245	7	260	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	7.25e-26	6	245	7	260	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P9WMX0	4.05e-16	6	292	86	362	Pre-mycofactocin glycosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=mftF PE=3 SV=1
P9WMX1	4.05e-16	6	292	86	362	Pre-mycofactocin glycosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mftF PE=1 SV=1
A0QSC1	1.19e-11	27	236	102	297	Pre-mycofactocin glycosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=mftF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003019_00066.