CAZyme Information: MGYG000003013_01531

Basic Information

• Species: Oribacterium sinus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Oribacterium; Oribacterium sinus
• CAZyme ID: MGYG000003013_01531
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286		33066.52	4.5344

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003013	2494431	MAG	United States	North America

• Gene Location: Start: 1310; End: 2170 Strand: -

Full Sequence      

MKIKKTQISFFPALLLCVFFLLTLSFCTKAESPKKDYGVFLGISGNTGIERKDKEALQKL
KSYRMVVLEPSNFSPEQIREIKTEGTKVYGYLNIGALENFRPYYEDFKKDSLAPYENWEE
EYWMDVSNPQWQDFLINSLGKQYAAMGLDGFFLDNTDIYYQYPKEEIYQGLKAILTGLKQ
YSLPLILNGGDTFVQKSIEDGSALSLFDGVNQECVFTKIDFSKPSYLSQDKETKAYYEEY
LEKAKTAGLSVYLTEYQANSELSQVIEQYCKENGFLWYNAESLELR

Enzyme Prediction     

No EC number prediction in MGYG000003013_01531.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	65	281	1.8e-60	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3868	COG3868	1.26e-22	60	269	77	287	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
pfam03537	Glyco_hydro_114	2.38e-20	64	278	18	213	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG2342	COG2342	2.51e-13	61	256	42	251	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
cd14745	GH66	1.78e-06	76	168	73	181	Glycoside Hydrolase Family 66. Glycoside Hydrolase Family 66 contains proteins characterized as cycloisomaltooligosaccharide glucanotransferase (CITase) and dextranases from a variety of bacteria. CITase cyclizes part of a (1-6)-alpha-D-glucan (dextrans) chain by formation of a (1-6)-alpha-D-glucosidic bond. Dextranases catalyze the endohydrolysis of (1-6)-alpha-D-glucosidic linkages in dextran. Some members contain Carbohydrate Binding Module 35 (CBM35) domains, either C-terminal or inserted in the domain or both.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH02333.1	1.21e-101	15	286	7	268
ACV23220.1	1.22e-101	31	286	12	258
ADK67932.1	5.94e-100	14	286	21	280
ACX83036.1	1.56e-93	14	286	9	273
ANN81722.1	3.13e-93	14	286	9	273

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000003	0.000852	0.999184	0.000000	0.000001	0.000000

TMHMM  Annotations     

start	end
7	26