CAZyme Information: MGYG000003013_00429

Basic Information

• Species: Oribacterium sinus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Oribacterium; Oribacterium sinus
• CAZyme ID: MGYG000003013_00429
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
741	MGYG000003013_6|CGC1	84093.03	4.3827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003013	2494431	MAG	United States	North America

• Gene Location: Start: 24488; End: 26713 Strand: +

Full Sequence      

MKFRKQLTLLLTMTGLGLLSHGTAFAETRTELWAKESQGYGAKLPYLRYEAEEGVGRDAV
LKHSTAYDEVEMEASNQSYVQLTKEDSSLRFTVKKAANAMTLRFTMPEDASGELEIFVER
NGELLGKKTVELDNSSAWQYVKENDVFDENIADSHSRFRFDERHFLLENDNKELMEMEEG
DVLTIRRTDKKADELGIDFIELEQAPEAKGAPSNSISITDAPYSAVPNDGQDDSQVFLDA
LKDADAENKTLYIPEGTFDFDQKLVLSATDMRITGAGIWYTRLHFTSEEQAGGGIEFLDS
SSNVEMDNLYMDSELKSRFHQEANYKGIAGVLGENSKLHDLWLEHFECGIWVGDYVEADK
MKYTKNLTVSNSRIRDNFADGVNFAQGTRNSKVQNSNIRGNGDDGLATFASKAILEIKEN
VNGVEQVRYIHTESKPAENNAFLNNTVELTWRASGIALHGGENHRIEGNLVKDITSGPGL
RVSTVFPGYNFDDNQNISIKRNLLIQTGTDNDFYGNALASIHFEKLFGEMKKMNVSDNRL
INSPHGKYSGNFYIPEEGTTEITLRNNEEKSIDVEPMLAEEEKNFAPLSEEEKLVEEQKK
AEEQKKAEELKKAAEQAEQAKHEGEQPGYDGALNIELHDQEEIPETANFRLYWFSGETEE
NGRTVRYWVKKLEGIHLDESMEYSLEDGTKVFNFTPDDIPEYIPISGTAFVEDYYYEGED
WIRWESPEGVEYVKIRYWSLK

Enzyme Prediction     

No EC number prediction in MGYG000003013_00429.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	33	567	2.6e-127	0.7989949748743719

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	1.93e-25	41	202	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
pfam13229	Beta_helix	6.36e-09	361	516	5	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.72e-05	292	421	46	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
PTZ00121	PTZ00121	2.38e-05	564	626	1515	1575	MAEBL; Provisional
pfam13229	Beta_helix	2.58e-05	380	567	1	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT35009.1	2.68e-142	40	741	33	665
ARI60364.1	1.31e-135	37	567	137	643
ARI57509.1	2.16e-135	37	567	137	643
CCB93603.1	2.54e-135	23	567	123	643
QMI50749.1	1.63e-134	37	567	137	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	2.25e-94	41	552	13	510	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
7C7D_A	1.06e-31	41	548	54	502	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]
6K0M_A	1.49e-14	39	510	12	445	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0Q_A	1.49e-14	39	510	12	445	Catalyticdomain of GH87 alpha-1,3-glucanase D1068A in complex with nigerose [Paenibacillus glycanilyticus],6K0U_A Catalytic domain of GH87 alpha-1,3-glucanase D1068A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
6K0S_A	1.49e-14	39	510	12	445	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000375	0.998754	0.000290	0.000223	0.000169	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003013_00429.