CAZyme Information: MGYG000003003_01511

Basic Information

• Species: CAG-1427 sp900539675
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427; CAG-1427 sp900539675
• CAZyme ID: MGYG000003003_01511
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837		94447.89	4.7036

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003003	1845572	MAG	United States	North America

• Gene Location: Start: 3080; End: 5593 Strand: -

Full Sequence      

MNVSFKTIRRSGDKAYILAEISGCDECLPLVLSASTDSGATIPSDTFPYCDVTDPLALRQ
VLYDGALAGEDLPLPPLQATMACVRYFVIALPWLDAKRWDLEFRSIDSAGDVVSSCKKSL
DIRSASLKALASQHTNPQTGELIEDLDGRFVHDRIHVSFLRAIESEGKLRVSALLEMPYH
DETKVECDFLDCHGHPRSLDYVVVEDSVAQPAEYGALRRRYMVVSFLVEKDNPRLCLCAT
DTQALVAPGFSMLGGRTLESLIEGFCLRATSAYDDPDYHRWFTEYHRADVPALLEQVATR
FDYEPTFSIVGLIADAPDHHIFDFVNSVAAQSYGKWELILVDMVGTQNRVSGLQELLDGD
ERMYIMDADLTLGMDDNFNAGLAAVEGDFVVFTRVCDIMAPDALFECVRAINEMPDCDFL
YTDVDTYDAQGIHSQPIFRPDFSPELLRSFNYIRDLVVIRQSLLGDIAPLSYSMFEAAGY
ELVLRATEKARHVYHIPRVLSHRRLATVDITESAMFSAIEQETGRKALVAHCQRMGFKAE
VLNEQNTGHYRVRYLLTEKPHVSIVVVHEGSPELLRTCIRSLYDKIHYRDFEVVVVDATD
HSEDTQQCLDDLFDTYDSFSSLPWHGPINRAAIGNYAAEHTQGDYLLYVGGDIRILTDDA
IEVLLGYFQSDDVAIVGPKQLFVDGTIEHAGIVVGGDRVVTPLFRHLPNDWAGYLERAQV
AQDVSAVTGECMMIRRTAFDEVAGFDEQLALFYPDVDFCLKTRQAGYRTVFTPYVELTHL
KSTSRLRIHSKELRLRRRREMAFLQASWPNVFVEGDEFYNPNLDQNSSYFALNHRKR

Enzyme Prediction     

No EC number prediction in MGYG000003003_01511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	560	790	3.6e-18	0.9347826086956522

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.94e-48	305	504	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.45e-28	564	780	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.41e-21	562	784	5	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.13e-12	563	739	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	4.39e-12	325	505	17	195	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV56006.1	7.71e-146	1	835	1	832
QOY61387.1	6.76e-120	85	823	58	797
ACV56016.1	1.78e-119	85	834	43	793
CBL21587.1	1.49e-113	277	832	254	812
QCU01344.1	1.49e-113	277	832	254	812

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	4.70e-72	277	823	292	831	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P55465	4.15e-67	294	832	355	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
P9WMY2	2.44e-06	676	784	125	240	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	2.44e-06	676	784	125	240	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003003_01511.