CAZyme Information: MGYG000003002_00118

Basic Information

• Species: Streptococcus sanguinis_H
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sanguinis_H
• CAZyme ID: MGYG000003002_00118
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
285	MGYG000003002_2|CGC1	32424.38	6.167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003002	1839775	MAG	United States	North America

• Gene Location: Start: 6647; End: 7504 Strand: +

Full Sequence      

MRKRIKPLAILIFFASFIAFILISKQITDSQEKQAQAKISQTKQTPSSSKKEETSDDSSL
DEEFISRPIIDISGWQLPSEINYDLLAQNVSGVIVRVHSGAQAKKENAATHLNGLDKSYE
RHIKEFQKRNIPVAVYAYVAANSKKEMEKEAESFYKASAKYHPTYYWLDVEEKTMSDMNA
GVEAFRAKLESLGVKNIGIYIGTYFMEEHSISTDKFTAIWIPTYGNDDGYYNAAPNTEQD
YDLHQYTSQGQLTGFSHYLDLNQLSTLKDQTATYQKLFTVPKESQ

Enzyme Prediction     

No EC number prediction in MGYG000003002_00118.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	70	254	1.5e-35	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06523	GH25_PlyB-like	2.04e-71	68	264	1	177	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	6.17e-57	1	279	1	268	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
cd06414	GH25_LytC-like	4.30e-21	70	262	4	188	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.06e-16	69	262	2	184	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	9.55e-11	70	262	3	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKQ43545.1	5.07e-200	1	285	1	285
VDY70920.1	1.45e-199	1	285	1	285
SQG30632.1	1.45e-199	1	285	1	285
QLB51970.1	5.91e-199	1	285	1	285
SQF70991.1	8.40e-199	1	285	1	285

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FF5_A	7.82e-108	1	281	1	266	Structurebasis of a novel virulence factor GHIP a glycosyl hydrolase 25 of Streptococcus pneumoniae participating in host cell invasion [Streptococcus pneumoniae]
3HMC_A	8.72e-23	69	264	7	179	Endolysinfrom Bacillus anthracis [Bacillus anthracis]
2NW0_A	1.66e-19	69	265	3	175	ChainA, PlyB [Bacteriophage sp.],2NW0_B Chain B, PlyB [Bacteriophage sp.]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.705555	0.286229	0.003961	0.001257	0.000757	0.002251

TMHMM  Annotations     

start	end
7	24