CAZyme Information: MGYG000003000_00801

Basic Information

• Species: Rothia aeria
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia aeria
• CAZyme ID: MGYG000003000_00801
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	MGYG000003000_54|CGC1	37767.31	6.7015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003000	1497242	MAG	United States	North America

• Gene Location: Start: 6420; End: 7463 Strand: -

Full Sequence      

MAQELYIATNNGDMGGGEVMLLNIARAARSLGYRVTVIGPAHPPQLVEAAADEGFARVVL
PARTRSQYMMQLRAWHSAHKKVLLWCNGLVPAAATGGRKNRIVHLHQIPEGLNAKLVPFA
RRKASATLVPSNFMARQINGAQVLSNWVSEVPTDLKHDNTDVIRVGFIGRLSPIKGIVPL
CKAIATLTQGGGAYRLVVAGEPVFTSEVEQEQVERSLSRIAEHTERLGWATPEALFNNVD
MLVVPSLVAESFGLVAAEAMSARVPLIVSDSGALPEIVGENYPYIVPKGDEAELARTISI
VAEQLSSDSEKLTNTVSDAFWRWQELYSPEAGKERVREILEQHISPA

Enzyme Prediction     

No EC number prediction in MGYG000003000_00801.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	165	300	7.9e-21	0.84375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	5.75e-37	13	341	12	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03823	GT4_ExpE7-like	7.57e-31	14	342	14	354	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
COG0438	RfaB	1.87e-27	14	346	14	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam13692	Glyco_trans_1_4	2.58e-22	164	298	3	132	Glycosyl transferases group 1.
cd03811	GT4_GT28_WabH-like	1.89e-21	7	320	4	346	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW92861.1	3.25e-250	1	347	1	347
BAV87415.1	1.88e-249	1	347	1	347
QQT89704.1	1.88e-249	1	347	1	347
VEI22475.1	5.16e-247	1	347	1	347
ADP40886.1	1.66e-155	1	344	1	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BFW_A	5.38e-07	167	311	41	187	Structureof the C domain of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
3L01_A	1.63e-06	167	311	256	402	ChainA, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]
2BIS_A	1.66e-06	167	311	257	403	Structureof glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_B Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_C Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
3FRO_A	1.66e-06	167	311	256	402	Crystalstructure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_B Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_C Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi]
6KP6_A	1.77e-06	167	311	243	389	Thestructural study of mutation induced inactivation of Human muscarinic receptor M4 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59002	2.01e-07	167	292	213	338	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
P26470	2.62e-07	167	278	198	316	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=waaK PE=3 SV=1
D6Z995	4.00e-07	165	299	258	400	D-inositol 3-phosphate glycosyltransferase OS=Segniliparus rotundus (strain ATCC BAA-972 / CDC 1076 / CIP 108378 / DSM 44985 / JCM 13578) OX=640132 GN=mshA PE=3 SV=1
A4FQ08	5.18e-07	161	291	232	370	D-inositol 3-phosphate glycosyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=mshA PE=3 SV=1
O07147	6.09e-07	167	295	193	320	Phosphatidyl-myo-inositol mannosyltransferase OS=Mycobacterium leprae (strain TN) OX=272631 GN=pimA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003000_00801.