CAZyme Information: MGYG000002999_00373

Basic Information

• Species: Rothia dentocariosa
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia dentocariosa
• CAZyme ID: MGYG000002999_00373
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MGYG000002999_15|CGC1	70578.78	6.8651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002999	876170	MAG	United States	North America

• Gene Location: Start: 8475; End: 10394 Strand: -

Full Sequence      

MPDESENSVSAPVCGVAQLGRPRVVAVVVTYNRQDLLPITLAGIAAGQVVPDAVVVVDNA
STDGTVEYLKNLSYSLPLDIITLSQNMGGAGGFAVGIDRALARHNPDLVWVMDDDTEPTE
NTLHESVQAWESYSPDRSRRPALIASRVVWTNGEDHPMNTMRTMFGAGSGRHRRAQAVGG
RPIRSASFVSLVMDAQVIRQNGGLPIADFFIWNDDFEFSTRLAHHRDAIAVPASVARHHT
KTFGTTNAKPGPRFYNDVRNKLWVFTRARTLSPLEKFLYGGSVARLWASTVLRTDEKSIY
LGYFLRGIKDALHAPRLNRDVLREVYDLEFPGHYGIQEDHDSFGAPQSQAEFSVLMSVYA
RESADHVEAAIASNAQYQTLLPAELVLVQDGPLPSEVCAVIDRWVERSRAGECAPIVTVK
LPQNVGLAAALNEGLNACSYGIVARADSDDISEPDRFATLIPALIESDCAVMGSAMYEVD
AQNTTVEATRQTVTDASRLADMMPSRNPLYHPTVAFYKDVVQRLGGYEYVPGAEDWWLWS
RVIAAGYKIGNVPEPLVRYRVGAGAYTRRGGLNAWKQDWAIQRRLYTGHAISKLGWIKNM
SVRTAYRFIPESTRRKAFRALTDIRPSRNVENSLQGKDA

Enzyme Prediction     

No EC number prediction in MGYG000002999_00373.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	26	163	6.9e-19	0.7588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04195	GT2_AmsE_like	1.35e-60	353	560	1	201	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04185	GT_2_like_b	6.82e-51	26	264	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.15e-21	20	313	1	302	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04184	GT2_RfbC_Mx_like	9.96e-11	352	561	3	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd02525	Succinoglycan_BP_ExoA	2.47e-10	353	561	3	209	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKI08991.1	0.0	1	639	17	655
ADP41172.1	0.0	1	639	17	655
QXT30376.1	0.0	10	639	2	631
QXW93103.1	0.0	23	621	23	621
VEI22762.1	0.0	23	621	63	661

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48215	5.08e-34	351	618	2	261	Uncharacterized glycosyltransferase HI_1695 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1695 PE=3 SV=2
Q46635	1.15e-32	352	610	2	252	Amylovoran biosynthesis glycosyltransferase AmsE OS=Erwinia amylovora OX=552 GN=amsE PE=3 SV=2
Q03084	5.36e-30	351	614	7	263	UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase OS=Escherichia coli OX=562 GN=wbbD PE=1 SV=1
Q4KXC9	5.03e-14	353	561	10	209	O-antigen biosynthesis glycosyltransferase WbnJ OS=Escherichia coli OX=562 GN=wbnJ PE=1 SV=1
A0R5Z2	6.86e-09	24	123	7	103	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002999_00373.