CAZyme Information: MGYG000002993_02132

Basic Information

• Species: CAG-170 sp000432135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-170; CAG-170 sp000432135
• CAZyme ID: MGYG000002993_02132
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728	MGYG000002993_41|CGC1	81913.49	5.4393

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002993	2537318	MAG	United States	North America

• Gene Location: Start: 15429; End: 17615 Strand: +

Full Sequence      

MENRKMQTEYGFPCREAKPVWLPDGSQPNRYVQFLQKFTWDGDGALSLQLSCDSRARVCL
NGERIGFAFYDGTDDTSWYETFDLSAAAVRGENTLEIEVWYQGVSSNCYTAGRAYVIFAV
MRGEGACAVASGAQTLCRADTAYRAGKVPTNQTGMVWYYDQTAEPQRYAPAAELTTDGRR
YAPRPIARQVLSGRKRAAVCAHGYLLPGDREPFESAFLSARGKNVQLDAGADRYEIWDCG
EESSGLLEIEVSSAAGCRVELGWGEHLDDLRVRSHIGSRMFQTAVTFGAGTHCFRHDFQR
IGMRYLEVHLHPLNGGTAQCLYAGVRPLDYPVTERGEFYCSDRLHMQIYRTAVHTLRLCM
HEHYEDCPWREQALYAMDSLNQAVCGYYCFGEYAFAAASLRMLARGMQADGFLELHTPGK
EVVTIPYFTFMWVLGVRDYLRYSGDRELVRALWPSIRLAAQCRLRECRDGLLPVPVETKY
WSFYEWNDLLSGEPIYRSELLAPRIDAPYQMFFLLFLDAAAELAEELGERGDAAMLHSGC
AEARRACHAMFWDAESGSYRTFAHETDGAFHAEDGAQSELVQALAVLSGTAGQAERERLL
PVLAAGKNDWVPCTLSMIRFKYEALLTRQEDYFDWVFADIARIWGRMLYAGATSFWETED
GADAFDQAGSLCHGWSAMPVYFYYAYGLGVRPVKPGFARTADAARRMDGCYGSVPTPEGM
IHVEKKAK

Enzyme Prediction     

No EC number prediction in MGYG000002993_02132.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	236	724	1.8e-75	0.9325396825396826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.87e-18	336	686	4	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	2.37e-05	390	536	299	446	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd19459	lipocalin_C1_moubatin-like	3.54e-04	25	109	4	97	Ornithodoros moubata CI, O. moubata moubatin, and similar proteins. The soft tick Ornithodoros moubata complement inhibitor CI (OmCI, also known as coversin) specifically targets C5, a member of the C3/C4/C5 protein family that orchestrates the assembly of the terminal C multiprotein complexes. O. moubata moubatin is a specific inhibitor of collagen-induced platelet aggregation. This subgroup belongs to the lipocalin/cytosolic fatty-acid binding protein family which have a large beta-barrel ligand-binding cavity. Lipocalins are mainly low molecular weight extracellular proteins that bind principally small hydrophobic ligands, and form covalent or non-covalent complexes with soluble macromolecules, as well as membrane bound-receptors. They participate in processes such as ligand transport, modulation of cell growth and metabolism, regulation of immune response, smell reception, tissue development and animal behavior. Cytosolic fatty-acid binding proteins, also bind hydrophobic ligands in a non-covalent, reversible manner, and have been implicated in intracellular uptake, transport and storage of hydrophobic ligands, regulation of lipid metabolism and sequestration of excess toxic fatty acids, as well as in signaling, gene expression, inflammation, cell growth and proliferation, and cancer development.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95627.1	2.18e-154	12	688	6	709
QNK57365.1	3.97e-152	13	724	3	752
QGQ97405.1	3.30e-151	16	723	8	752
ARN56684.1	5.24e-105	16	724	22	751
AQQ71631.1	2.30e-97	15	726	8	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.13e-35	238	719	442	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	2.04e-26	236	723	195	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002993_02132.