CAZyme Information: MGYG000002988_00905

Basic Information

• Species: Pauljensenia sp900556405
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp900556405
• CAZyme ID: MGYG000002988_00905
• CAZy Family: CBM47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
922	MGYG000002988_79|CGC1	98641.11	4.2058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002988	1973013	MAG	United States	North America

• Gene Location: Start: 18; End: 2786 Strand: +

Full Sequence      

MGPWESIRSIYPACWGYCSWANRDESAKNYKERELVNNLIGTVASGGQFAYNVGPKGDGT
IDAFDSGVVTEVGQWMARHPDAITGARPTWFPAPDWGKVMTKGNDLYFFPELWSPGKTLT
LPSVGGHVSAVTVDGTDRALDFSQDGTTLTVTMSGDNPEPNLRPVIKVTFDGAPTYIPTQ
TVTAVDGATISSEQFFGRASAMRYSGPQAYDAYLVNKGDKAITDLTVKFSGNFDASTTYK
ITLGTTSIEVTGAQIEAGEVGEGLVLEPGQVTPLRLELAHPAYYADPIRLGSVSATVHVY
DENAATQPPVIATDPSSVSVKVGESATFTVVASGRPAATIQWYRVPKGATEGTAIPDATS
SMYTLTTTLEDDGAQFYAVATNANGSTTSARATLTVTKGSDNIALNKTATMSSTGWGGTA
SRAVDGNTDGVWDNGSVAHTGKQANPWWEVDLGEDHSLGVVNVWNRSSSDNCQGISCDQR
LHDFWVVASTTRLDASFNPATAGAVDGVHAIKVDGVGGRPSAVDFEGFDARFIRVIQPTE
FGEFALAEVEAFEAAAPTPDPGDQEPPVIKPLTVTANPSEDAQISGDGAFRTVTGKEGTQ
VTITAEATGTPTPTLIWQIKREGSDSWSIVEDENGPELTLTIDGESNGSVVRVMAMNEAG
VAESGLVTLALAEEPAPAPDPTPDPAPTPDPTPAPDPTPDPAPTPDPTPDPVPTPDHTVG
TWMNDGTGWWWKITGGDYAKNETLTLDGRVYRFDQNGYMLTGWVYWDGAWRYHNGAGAQV
TGWVNLGGSWFYLTPETGAMVTGWQMVADKWFFFASNGVMATGWLYTGGAWYYLDPSGAM
YTGWLQMGSHWYLMSDSGAMTIGWKPLGSTWYYFGASGQMATGWQQIGGVWYYFGTGGDM
YTGGHWIGWRWYTFGSDGRWLG

Enzyme Prediction     

No EC number prediction in MGYG000002988_00905.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM47	410	543	3e-23	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	6.15e-50	722	912	445	634	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	3.63e-48	761	918	443	599	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.22e-47	761	918	486	642	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	2.05e-47	727	912	486	657	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	4.82e-47	699	912	394	613	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT36484.1	0.0	1	817	268	1072
QGS10838.1	0.0	1	818	273	1078
AKU64744.1	0.0	1	779	273	1022
QQC44719.1	0.0	1	779	253	1002
AOS46753.1	2.59e-230	1	764	288	1056

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LE0_A	9.33e-18	401	555	10	147	ChainA, Platelet aggregation factor Sm-hPAF [Streptococcus mitis],3LEG_A Chain A, Platelet aggregation factor Sm-hPAF [Streptococcus mitis],3LEI_A Chain A, Platelet aggregation factor Sm-hPAF [Streptococcus mitis],3LEK_A Chain A, Platelet aggregation factor Sm-hPAF [Streptococcus mitis]
4GWI_A	3.21e-17	401	555	10	147	His62 mutant of the lectin binding domain of lectinolysin complexed with Lewis y [Streptococcus mitis],4GWJ_A His 62 mutant of the lectin binding domain of Lectinolysin complexed with Lewis b [Streptococcus mitis]
2J1R_A	1.25e-15	399	552	14	148	Structureof a Streptococcus pneumoniae fucose binding module [Streptococcus pneumoniae TIGR4],2J1R_B Structure of a Streptococcus pneumoniae fucose binding module [Streptococcus pneumoniae TIGR4],2J1S_A Structure of a Streptococcus pneumoniae fucose binding module in complex with fucose [Streptococcus pneumoniae TIGR4],2J1S_B Structure of a Streptococcus pneumoniae fucose binding module in complex with fucose [Streptococcus pneumoniae TIGR4],2J1T_A Structure of a Streptococcus pneumoniae fucose binding module in complex with the Lewis Y antigen [Streptococcus pneumoniae TIGR4],2J1T_B Structure of a Streptococcus pneumoniae fucose binding module in complex with the Lewis Y antigen [Streptococcus pneumoniae TIGR4],2J1U_A Structure of a Streptococcus pneumoniae fucose binding module in complex with the blood group A-tetrasaccharide [Streptococcus pneumoniae TIGR4],2J1U_B Structure of a Streptococcus pneumoniae fucose binding module in complex with the blood group A-tetrasaccharide [Streptococcus pneumoniae TIGR4],2J1V_A Structure of a Streptococcus pneumoniae fucose binding module in complex with the blood group H-trisaccharide [Streptococcus pneumoniae TIGR4],2J1V_B Structure of a Streptococcus pneumoniae fucose binding module in complex with the blood group H-trisaccharide [Streptococcus pneumoniae TIGR4]
2J22_A	1.06e-10	402	552	14	145	Structureof a Streptococcus pneumoniae fucose binding module, SpX-3 [Streptococcus pneumoniae TIGR4]
7LJJ_A	7.98e-10	3	158	325	499	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P04066	3.87e-07	4	145	293	435	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4
P17164	6.68e-07	4	145	289	431	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
Q9I926	1.02e-06	420	481	65	119	Fucolectin-6 OS=Anguilla japonica OX=7937 PE=2 SV=1
Q7SIC1	1.14e-06	401	481	9	87	Fucolectin OS=Anguilla anguilla OX=7936 PE=1 SV=1
Q99LJ1	1.50e-06	4	145	279	421	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002988_00905.