CAZyme Information: MGYG000002983_00235

Basic Information

• Species: Gemella sp900555985
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Gemellaceae; Gemella; Gemella sp900555985
• CAZyme ID: MGYG000002983_00235
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	MGYG000002983_2|CGC1	50789.51	5.0713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002983	1248288	MAG	United States	North America

• Gene Location: Start: 13904; End: 15214 Strand: -

Full Sequence      

MLANNWKQNLHLEPEKGWLNDPNGLAYFKGKYHIFHQYSYEVNGGLKLWYYYTSSDLKKY
EDRGVFLTPTIEEEKSGVYSGSANVEGDKLVFYYTGNVKYKGDYDYVHAGRGHNTISFST
EDGVNFTEKKCLLTTDDYPNMSNHVRDPKVFEKNGKNYLVLGARDSNDYGCLLVYDKDTL
EPYKTIYSEKNLGFMWECPDYFEVDGKEIFMFSPQGISRMYPNYENMYQIGYSVVEEGIE
NVEKLNNFSLLDYGHDFYASQTFLDEDNNRVLIGWMYVPDSSYTNPTTKFGYQNCLTIPR
VVNYKDGKVRQTLHKSVKELLGENIKDSDFTEKTWYYKQEHGHEFEIEIADFKVSYKDSE
LKVDFGTSGYGRDNRKYKVNIENVEIVFDSSSIELFANDGSFALSTRFYPNNHNVKISAN
NYIAQKLGKIEIREEK

Enzyme Prediction     

No EC number prediction in MGYG000002983_00235.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	11	311	1.2e-74	0.9897610921501706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.37e-127	17	306	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	3.63e-94	1	421	23	472	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
TIGR01322	scrB_fam	3.39e-93	2	411	9	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam00251	Glyco_hydro_32N	3.63e-83	11	312	1	307	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	2.58e-77	11	400	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS07836.1	0.0	1	435	1	435
QIX88435.1	2.52e-299	1	435	1	435
VEI38159.1	4.45e-293	1	435	1	435
QGS08809.1	1.07e-284	1	435	1	435
SQH54893.1	4.15e-282	1	435	1	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BWB_A	1.73e-49	6	409	48	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	2.43e-48	6	409	48	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	2.47e-46	6	418	32	471	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7VCO_A	1.20e-41	11	410	30	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
1UYP_A	5.80e-39	6	431	2	428	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13394	1.34e-63	9	414	39	458	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
Q05936	2.37e-63	6	413	33	467	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P16553	3.45e-61	3	410	20	449	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P07819	2.20e-58	7	419	29	465	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q04937	1.03e-57	2	431	28	472	Sucrose-6-phosphate hydrolase OS=Lactococcus lactis subsp. lactis OX=1360 GN=scrB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002983_00235.