CAZyme Information: MGYG000002977_00892

Basic Information

• Species: Bifidobacterium vaginale_F
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium vaginale_F
• CAZyme ID: MGYG000002977_00892
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000002977_52|CGC1	35719.44	9.0476

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002977	1471933	MAG	United States	North America

• Gene Location: Start: 5918; End: 6904 Strand: +

Full Sequence      

MTSHRKHTVTLKSLSMRQWAILIASVISAIALVVLVVVSRNFYESSAPQATPVTSYSATE
NLTTVSRGAVRDVLNSNTSYITVVINGHHRTILGTNFTDVRSVLNAGDITLEPHDVVTPS
LDTRVKESTVITIQREGAKLETSDDDIAFNVVKKETAALPKGTEKVQQNGVNGVMETAKL
VTHVGKKVVSSNIFASYVKKAPKDKIILVGTGGELAGSPADISLGTTVPAGEMQNWAHDW
LLSNGYSEADFTATVFIISHESGWRVNAMNPSGAYGLPQALPGGKMASAGADWATNYQTQ
LKWFWNYCNRRYGSIQGAYQYWMVHHNY

Enzyme Prediction     

No EC number prediction in MGYG000002977_00892.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07501	G5	6.58e-17	139	211	2	74	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
COG3583	YabE	1.04e-16	78	221	149	293	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam03990	DUF348	1.04e-07	81	122	1	41	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.
cd13925	RPF	0.004	256	284	5	34	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APW18388.1	4.10e-163	1	328	1	328
ADB14142.1	4.76e-162	1	328	1	328
AYZ21521.1	9.47e-147	1	328	1	334
VEH16994.1	1.34e-146	1	328	1	334
BAQ32923.1	1.34e-146	1	328	1	334

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43