CAZyme Information: MGYG000002946_02200

Basic Information

• Species: Enterocloster sp900555905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900555905
• CAZyme ID: MGYG000002946_02200
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000002946_236|CGC1	37283.2	7.6846

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002946	4682631	MAG	United States	North America

• Gene Location: Start: 1583; End: 2554 Strand: -

Full Sequence      

MEAEKVMASINCVTFNHVNYIRKALDSFLMQKTNFAFEILVHDDASTDGTGEIIREYAEK
YPDQVRPLIQTENQYSQGIDNISGAFNFPRARGKYIFMCDGDDYFLSPDKLQRQVDYMEA
HPDCALCIHSARIDLVGKALTEGQMRPYRQSRVIPPEEIIDKSSGYAMSSMAFPARLVKI
LPDYYVDCPVGDTPLQLMAAAEGYGYYMDEPMSAYRVGVAGSWTVEGQSGDYEGKQNAYY
RRMKRTYEQFDRATGGRFHQAAESAALRTYYHTKVNTKKFDEIFNPEYRRYYKELTPRTR
FFLRFERSMPGAYKMARKAFTGR

Enzyme Prediction     

No EC number prediction in MGYG000002946_02200.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	13	131	4.6e-19	0.6647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04196	GT_2_like_d	4.80e-27	6	216	3	203	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	2.22e-23	14	128	5	112	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	2.39e-21	13	127	5	112	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04186	GT_2_like_c	1.17e-13	13	127	4	108	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	1.95e-13	14	136	11	122	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU21876.1	1.76e-206	6	323	18	335
ASN93813.1	8.34e-205	6	323	18	335
QRP41523.1	8.34e-205	6	323	18	335
QQQ98687.1	9.72e-204	6	323	18	335
ANU46597.1	9.72e-204	6	323	18	335

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P64864	4.03e-27	9	223	2	208	Uncharacterized protein Mb1547 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1547 PE=4 SV=1
P9WLV4	4.03e-27	9	223	2	208	Uncharacterized protein MT1570 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1570 PE=4 SV=1
P9WLV5	4.03e-27	9	223	2	208	Uncharacterized protein Rv1520 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1520 PE=1 SV=1
P22639	1.17e-10	9	143	4	135	Uncharacterized glycosyltransferase alr2836 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr2836 PE=3 SV=2
P71054	6.03e-08	15	216	14	207	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002946_02200.