CAZyme Information: MGYG000002941_00054

Basic Information

• Species: Actinomyces graevenitzii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces graevenitzii
• CAZyme ID: MGYG000002941_00054
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000002941_1|CGC1	36896.44	5.022

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002941	1921862	MAG	United States	North America

• Gene Location: Start: 63820; End: 64833 Strand: -

Full Sequence      

MSALVSVIMRTRNRPIFLSRALASVQAQQLGDYELIIVNDGGETQIVQAALDKTSPKLQA
RTQVVTNRVSNGREAALESGLACASAPFFAIHDDDDTWDPQFLSQTVAFLQAHPHLGAVA
ARTQLVSEKLESDGTITILERADLALERHSFNLIDMLVGNYIPPISQLIRRTSADLVGHW
DGRLSTQADWDFNLRLLQAQPAGFLEGPALAFWHQRPGLAGESGNSVITAALEHQQDNLA
IRESYLRTDSPNPLLGQALVSAEYYRRSQAQLEQVSQGVHEALNLVHADLNQQVAALTKQ
VQQLSEQVAQLQELTGQLQESTLTAQLGKLRGSVNTD

Enzyme Prediction     

No EC number prediction in MGYG000002941_00054.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	124	2.2e-18	0.6882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	1.22e-18	7	126	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	2.15e-17	6	122	1	115	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04184	GT2_RfbC_Mx_like	1.47e-16	4	199	2	186	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd06433	GT_2_WfgS_like	2.48e-14	6	201	1	181	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	1.10e-13	1	111	1	108	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT35087.1	3.46e-103	1	286	1	291
QGS11463.1	9.82e-103	1	286	1	291
QCT33770.1	7.38e-92	5	274	11	294
BAV84843.1	9.47e-92	5	274	11	294
QLF54048.1	2.15e-90	5	273	11	293

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39614	6.34e-11	5	195	3	181	Uncharacterized glycosyltransferase YwdF OS=Bacillus subtilis (strain 168) OX=224308 GN=ywdF PE=3 SV=1
P22639	2.63e-08	5	119	3	115	Uncharacterized glycosyltransferase alr2836 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr2836 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002941_00054.