CAZyme Information: MGYG000002933_00575

Basic Information

• Species: Phocaeicola sp900540105
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900540105
• CAZyme ID: MGYG000002933_00575
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793	MGYG000002933_6|CGC2	91252.26	6.1181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002933	3120707	MAG	Estonia	Europe

• Gene Location: Start: 55582; End: 57963 Strand: +

Full Sequence      

MITCFLFHDHSCPSDNTVTNLKDCLPTARIVTPDELDLPAASMESTEMLHKVVSMADTPY
TLFYIKPQPLELGYKALERMCDYLNAPETGMVYADHYRWEDGTRKPHPVADYQPGSVRDD
FDFGSVMLFKTECLKNAFRLMGAQPDYEYSALYALRLALTRTHELTHIREYLYTEMEEND
TRRPEEKQFDYVDPRNRQVQVERERAFTYYLKDIGAFLPEPTEGIDPQKGDFEYEASVII
PVRNRVRTIGDAIRSAVEQQTDFPFNVIVIDNHSTDGTADIIARYADDRRVIHLVPSRTD
LGIGGCWNVGIDHPLCGRFAVQLDSDDLYSSPATLQTIVDMFRRERCAMVVGSYRMTDFN
LHTLPPGVIDHREWSRENGHNNALRVNGLGAPRAFYTPLLRQMRIPNTSYGEDYALGLCF
SRRYRIGRIYDVLYLCRRWEGNSDAALSIEQINRNNAYKDSLRTLEIRLRQELAKHLDAS
APCPPKEAFFAGQFEKWELAKNNHRELNRIRLRSFRIGDSDILVQYNPERAVSTCAKLDK
ASIEARPCFLCEENKPEAQSSIRIGIDEGFTLRVNPYPILPEHLTLSAVRHQPQVLADKT
DRQLPGRLLEWMDEHFAKGYALFYNGAKCGASAPDHFHFQAALQQDIPFIRQWKRLMLTA
DELGRCELETGGCCTEYRINNYPCTVHAFVSERGYKYAPRLVTRYLNSLPQHTGEAEPRY
NLFAWMDEARGFTLAYFPRKEHRPQCYAANDDTQRLISPGALDMGGIIVTCREKDFEGIT
ADDIRQIYREVTL

Enzyme Prediction     

No EC number prediction in MGYG000002933_00575.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	237	364	1.4e-19	0.7352941176470589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	3.05e-60	619	793	14	182	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
cd00761	Glyco_tranf_GTA_type	3.13e-23	238	356	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	2.37e-20	237	444	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	3.67e-18	237	353	1	114	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	1.62e-17	237	478	6	218	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO26250.1	0.0	2	790	5	792
ADY35406.1	0.0	2	793	5	780
QUT58622.1	1.76e-272	2	791	5	802
QQY43387.1	1.76e-272	2	791	5	802
ABR40252.1	1.76e-272	2	791	5	802

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002933_00575.