CAZyme Information: MGYG000002910_01068

Basic Information

• Species: Slackia exigua
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Slackia; Slackia exigua
• CAZyme ID: MGYG000002910_01068
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000002910_11|CGC1	40190.06	7.456

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002910	1892476	MAG	United States	North America

• Gene Location: Start: 51742; End: 52818 Strand: +

Full Sequence      

MVHTYAATAASGMPAAPSTRPIVSFVVPCYNSAAYMRTCIDSLVPALDCCEAIIVNDGST
DATLAIAREYETAYPDSIRVIDQENAGWGGGVNNGLACARGTYFKVVDSDDWLDVPAFNR
VLDVLKAHATPETAFDLVFSNFVYDHVTDGTKHAIRYGGLMPQDRPFGWEEFGKPRIDQY
IMVHATWYRTDLLRESGVTLPTNVCYMDGYLMLHPLPLVKRLYYVNADVYHYLIGREDQS
IGIETVKKRIDQQLLATRLCIGDHDFNRLKQQDPPMAELYARYVSAMMSVSTIHLFMIGT
PEAIAKNRELWAYMKRANPALHAHVARSLAGFANRRTALFRKAAVAIFSYAQRKYKFA

Enzyme Prediction     

No EC number prediction in MGYG000002910_01068.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	24	128	7.7e-24	0.6235294117647059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	9.72e-24	26	128	2	105	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	2.44e-22	24	128	1	106	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PRK10073	PRK10073	1.95e-21	18	241	3	222	putative glycosyl transferase; Provisional
COG0463	WcaA	2.95e-21	20	321	2	284	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04188	DPG_synthase	1.66e-15	25	127	1	109	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANE23518.1	8.24e-101	27	358	1	332
QBB66817.1	2.92e-95	22	357	3	339
ALP95010.1	2.92e-95	22	357	3	339
ANU39958.1	1.25e-94	22	357	4	341
QQR07208.1	1.25e-94	22	357	4	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z86_A	3.16e-14	21	248	375	587	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	3.16e-14	21	248	374	586	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
3BCV_A	1.57e-12	18	128	2	112	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5HEA_A	1.29e-11	22	114	6	98	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71057	5.54e-17	21	261	4	233	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
P71059	7.94e-14	21	123	3	105	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
Q8L0V4	1.83e-13	21	248	432	644	Chondroitin synthase OS=Escherichia coli OX=562 GN=kfoC PE=1 SV=1
A0A0H2URH7	1.40e-12	23	240	7	223	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
E0U4V7	4.22e-12	23	246	3	217	Poly(ribitol-phosphate) beta-glucosyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002910_01068.