CAZyme Information: MGYG000002907_02318

Basic Information

• Species: Anaerosporomusa sp900542835
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Sporomusales; Acetonemaceae; Anaerosporomusa; Anaerosporomusa sp900542835
• CAZyme ID: MGYG000002907_02318
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000002907_31|CGC1	39214.85	7.4529

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002907	3559920	MAG	United States	North America

• Gene Location: Start: 3327; End: 4394 Strand: +

Full Sequence      

MRYSKIFVVALAALLVAGMAWGGCGQQAAPKPLPEQPGEPAAAQYPRLIIGYYENPWPGT
PDKTGSFPSMKAYGQHMTAVAPFWYRAKADGTLDAKESELVLAAARQQGLKIYPLITNRS
GATDQLLGNAAVRSKVIGNIVKLVQDKQYDGVNIDFELLKPAHKDNLTAFMRELYPQLKQ
LNKTVIISIFPKVDVHEDVSGAYDYPQLAKNADYLQIMTYDKHWATSKPGAIAPLDWYEK
NIQYAIEQAGGPQKLIIGVSAYGYDWPPDAPGETITYVDAVVLAKQQGVKIEYDETAQAP
HFAYKGHEVWFEDARSTAAKLAVVAKYNPAGIAIWRLGQEQPEAWNEIAAKFPKK

Enzyme Prediction     

No EC number prediction in MGYG000002907_02318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	49	342	2.9e-46	0.9358108108108109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	8.31e-106	49	348	4	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	4.14e-68	40	352	95	422	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	1.18e-43	66	345	13	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	6.41e-33	96	339	53	333	Glyco_18 domain.
pfam00704	Glyco_hydro_18	3.39e-32	102	339	56	306	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJW48858.1	3.01e-178	23	355	7	342
QJW48859.1	3.01e-178	23	355	7	342
AJQ29825.1	7.02e-176	1	355	4	368
AIF49572.1	1.51e-175	1	354	1	360
QDR82773.1	1.08e-173	2	355	6	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3J_A	1.38e-40	61	352	117	425	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	3.92e-38	75	352	133	427	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4WIW_A	1.12e-36	109	338	73	330	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
3CZ8_A	3.14e-36	73	337	29	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	2.21e-35	49	348	4	310	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9K3E4	1.93e-39	61	352	116	424	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P0DPJ9	2.69e-39	61	352	116	424	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
O32258	2.77e-37	48	348	30	339	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
P37531	7.29e-36	76	352	130	423	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O05495	1.17e-35	73	337	121	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000053	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29