CAZyme Information: MGYG000002905_01855

Basic Information

• Species: CAG-279 sp900541935
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900541935
• CAZyme ID: MGYG000002905_01855
• CAZy Family: GH133
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
760	MGYG000002905_60|CGC1	86710.97	6.3393

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002905	2448974	MAG	China	Asia

• Gene Location: Start: 9144; End: 11426 Strand: -

Full Sequence      

MKRLFLPLMLTACSLFSNAATTIDDLGITTSKQREYSFSDKNAGFFYGMTNTDNFKEFYA
GWNIEAHRIFSDYTITVNGKPLSKETAKTTVYPNRLERIYADGTTETLYLVDGKKIIFID
INNTNGALGLKLKGENLPEPIISGGNANYQFKDLQNRVLAVCTPDAPCQIKDGIIETDSK
KGFIITFGTQEINDILISEAKKDKEQLLNSRKERMQQLVDNNRTDCNSEDASKALHWLRL
TADELVTNQHGGWGIYAGFPWFTDFWGRDMFIAMPGTSLCSGQFDIAKDILQSFAKYMDT
DPKSETYGRVPNRLNLEGILYNTTDGTPRFVIQVYDYLKYTGDKEFIKSIYKNIKMATDA
SIDKYADENGYLTHADADTWMDAKRQGKKPCSPRGNRAVDIQALWYEQLEAAAKLADYMG
KKKDAEKWRGVAQKLHSNFEKDFISNGIIADHLNEDNSRDTQLRPNTMYAYNLVSNDSVK
MADIRTTWSHLVYPWGVSSLDQMDDQFHPYHEQWHRYHKDDAYHNGTVWLWQNGMAMQRM
IEYGQKDKAYQLFRNMNLQALHIGAVGSLSECADPWCRPGKTIAKLSGTFLQSWSNSEQL
RVWSQYFLGVKPNMLEKEITIAPRLPKDLQKISATVNIADGKIIYTATAEQAYNIEWTGT
ATTEFKFDLEGVKNFSIEMNKGDKISIEGLSTLTPTATVFNKDGKQIKSINLEADAEKIK
FAEKCAEFFKNTDFAKPCYRENLKSMSRYFDPPLDYYSIE

Enzyme Prediction     

No EC number prediction in MGYG000002905_01855.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH133	252	601	4.9e-65	0.9731182795698925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06202	GDE_C	3.79e-81	240	601	1	374	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	2.64e-51	228	631	248	629	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
TIGR01531	glyc_debranch	1.33e-14	257	546	1025	1400	glycogen debranching enzymye. glycogen debranching enzyme possesses two different catalytic activities; oligo-1,4-->1,4-glucantransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). Site directed mutagenesis studies in S. cerevisiae indicate that the transferase and glucosidase activities are independent and located in different regions of the polypeptide chain. Proteins in this model belong to the larger alpha-amylase family. The model covers eukaryotic proteins with a seed composed of human, nematode and yeast sequences. Yeast seed sequence is well characterized. The model is quite rigorous; either query sequence yields large bit score or it fails to hit the model altogether. There doesn't appear to be any middle ground. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam17389	Bac_rhamnosid6H	3.11e-07	331	451	104	223	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	9.69e-07	324	453	98	234	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO71213.1	7.34e-279	26	760	46	785
QUT90346.1	2.86e-278	17	759	37	784
ALJ58547.1	1.37e-276	12	760	28	785
QCD35869.1	1.53e-230	23	760	37	781
QNE40753.1	7.51e-211	8	756	14	777

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000752	0.681340	0.316999	0.000312	0.000312	0.000266

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002905_01855.