CAZyme Information: MGYG000002905_01166

Basic Information

• Species: CAG-279 sp900541935
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900541935
• CAZyme ID: MGYG000002905_01166
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000002905_23|CGC1	41885.87	4.6737

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002905	2448974	MAG	China	Asia

• Gene Location: Start: 7832; End: 8968 Strand: -

Full Sequence      

MKRLSFLSIICLALLSCGDDNGANGQEPQNVSISCSPSNVEFTKDGGKSIVLVTVIGSEW
TVEADKNDWLTVTVSKISASSANVTIAAQPNTTTEKRTCNVTVTANAENKKVINVTQAPK
EKYDGEEVNIVTPEGYTLVWHDEFSEEGSLSSDWTHEVQKAGWVNNELQNYVRETSPSGR
KVTELVAGHLAINCFEEDGKVYSGRVYAKVDEGWKYGYFEARIKLPSGKGTWPAYWMMPV
GNDWSTNPWPKCGEIDIMEEVGCVPNEVSSSIHTQDYNHTIGTQKTHAMTLADAEGAYHV
YALEWTEDAITTYVDGKVQLAVTKKELGSDHNQWPFHYAFYPILNLAWGGMWGGMNGVDP
SALPVTMEVDYVRIFQKK

Enzyme Prediction     

No EC number prediction in MGYG000002905_01166.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	140	375	4.5e-67	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	4.54e-73	140	375	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02182	GH16_Strep_laminarinase_like	3.57e-29	135	376	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd08024	GH16_CCF	1.11e-27	138	347	1	273	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd00413	Glyco_hydrolase_16	4.77e-27	142	375	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
pfam00722	Glyco_hydro_16	1.22e-21	216	336	33	140	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA28932.1	1.17e-162	1	378	1	453
BBK87699.1	1.17e-162	1	378	1	453
QUT60462.1	2.74e-162	1	378	26	478
QUT35631.1	2.74e-162	1	378	26	478
QPH56444.1	3.33e-162	1	378	1	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ILN_A	1.03e-58	136	376	5	248	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
6XOF_A	3.49e-58	133	378	21	269	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	1.94e-57	133	378	21	269	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
6JH5_A	6.73e-46	134	377	2	233	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	5.16e-45	134	377	2	233	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45798	1.44e-58	136	376	40	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	5.45e-35	124	378	406	682	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q27082	1.82e-32	136	376	25	253	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
C1IE32	7.39e-30	136	373	20	265	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q9ZG90	7.37e-25	136	376	56	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000625	0.999428	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002905_01166.