CAZyme Information: MGYG000002904_03957

Basic Information

• Species: Phytobacter diazotrophicus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter diazotrophicus
• CAZyme ID: MGYG000002904_03957
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000002904_42|CGC1	44649.55	6.5028

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002904	5266198	MAG	United States	North America

• Gene Location: Start: 5122; End: 6321 Strand: +

Full Sequence      

MKRFTPALLAVCLCSLSASSFAADALKTRPFSGMPADFIKGADISTLLDAEKHGAKFYND
KNQPQDALAILKANGVNYVRLRLWVDPKDAQGQAYGGGDNDLATTLALAKRAKAQGMKLL
LDFHYSDFWTDPGKQFKPKAWEKMDYPQLKTAIHDYTRDTIARFKQEGVLPDMVQIGNEI
NSGILWPEGKSWGQGGGEFDRLAGLLNSAIDGLKENLKNGEQVKIMLHLAEGTKNDTFRW
WFDEITKRNVPFDVIGLSMYTYWNGPISALQANMDDISKRYNKDVIVVEAAYAYTLANCD
NAENSFQEKEEKAGGYPGTVQGQYDYIHDLMQSVINVQSHRGKGIFYWEPTWIAVPGNTW
ATQAGMNYINDKWKEGNARENQALFDCQGKVLPSVKVIN

Enzyme Prediction     

No EC number prediction in MGYG000002904_03957.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	39	397	1.7e-147	0.9941520467836257

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3867	GanB	0.0	1	399	2	392	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	1.25e-145	39	397	1	332	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJF17541.1	7.49e-305	1	399	1	399
BBE77481.1	7.49e-305	1	399	1	399
QIH63259.1	3.05e-304	1	399	1	399
AUU91285.1	6.15e-304	1	399	1	399
AUV08696.1	6.15e-304	1	399	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	4.16e-102	24	397	36	390	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	3.45e-90	19	397	5	387	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	2.74e-89	19	397	5	387	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	7.99e-60	40	353	5	301	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	7.93e-56	40	353	5	301	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65CX5	3.97e-89	19	397	30	412	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
P48843	9.87e-87	38	398	6	346	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
O07013	1.25e-82	19	397	34	416	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
P48841	2.21e-61	38	390	27	355	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
P83692	4.38e-59	40	353	5	301	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000261	0.998998	0.000199	0.000188	0.000177	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002904_03957.