CAZyme Information: MGYG000002903_00005

Basic Information

• Species: Negativicoccus succinicivorans
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Negativicoccaceae; Negativicoccus; Negativicoccus succinicivorans
• CAZyme ID: MGYG000002903_00005
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000002903_1|CGC1	38532.3	9.8071

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002903	1204906	MAG	United States	North America

• Gene Location: Start: 3089; End: 4129 Strand: +

Full Sequence      

MELNLPQARILIIKMSSLGDIICALPALFALRKKYPHAHITWAVHHAFKDILPGTPYLDD
KVVIDRNRLRQPSYWRELHRELRERSFGLVLDLQMLAKSALVARLSGAKARYGYWEAREG
SGLVSQPIVGAHQYGHITERLLDVVEYFGADIDRIAYPLCDISDAEVTLRQKLQALGVTG
EYIVIAPSSRGAGKDWPETSWRELIGQMTADGRHVVIAGSAADTPLAQRLLAGDRTKRAA
DLTGQTSLRELLALEKHARMHISGDTGPLHIANAYGTSIIGLYGPTRPERSGPFHNPQGD
YVTAQQAQNADLKIKKNRNIAMSTIPVEDVITLYRKKINAEQKKRP

Enzyme Prediction     

No EC number prediction in MGYG000002903_00005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	76	306	4.1e-53	0.9022222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.36e-68	9	342	3	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	7.58e-65	9	336	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR02193	heptsyl_trn_I	8.91e-42	9	298	1	295	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	6.12e-39	75	293	1	219	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	1.66e-28	5	343	3	348	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOH38976.1	2.18e-100	9	330	4	317
BBK25036.1	2.16e-96	9	325	8	316
AXB80809.1	3.62e-96	9	302	6	298
VEG93746.1	2.43e-93	9	341	6	338
CCC73398.1	1.11e-92	9	302	6	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	3.58e-16	4	331	5	338	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	2.47e-15	9	298	2	294	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	2.47e-15	9	298	2	294	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	2.64e-15	9	298	2	294	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
1PSW_A	2.95e-15	9	293	2	297	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	2.03e-20	19	331	5	324	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q57336	2.57e-19	12	316	13	312	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
Q9R9D5	2.86e-18	19	331	5	324	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P37692	1.44e-15	9	293	2	297	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P26469	4.98e-15	9	298	2	294	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002903_00005.