CAZyme Information: MGYG000002898_01415

Basic Information

• Species: Haemophilus_D pittmaniae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D pittmaniae
• CAZyme ID: MGYG000002898_01415
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000002898_8|CGC1	40819.59	9.4379

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002898	2077686	MAG	United States	North America

• Gene Location: Start: 40507; End: 41592 Strand: -

Full Sequence      

MMKKYFVLALIPFLFACGSSNTHHRRGINFDEVFAKDTQGLDILTGQFSHNIDRIWGVNE
LLVATRKDYVKYNDNYYTRSHVSFDEGSIIVETQKDLNRLHNAIVHTLLMGSDPKGIDLF
ASGDVPISSRPFLLGQVVDNNGQQISNEMIASNYATWLIQNKLQTRRLQNGNVVQFVVIA
MIANHVEVRAQKYIPLIRKAAQRYGIDESLILGIMQTESSFNPYAISYANAVGLMQVVPS
TAGRDVFAMKGLSGQPTQRYLYDPANNIDAGVAYLWLLQNKYLDGITDPASKRFAMISAY
NSGAGAVLRVFDEDKDEAIYQINRMYPEQVYRILTTAHPSSQARNYLLKVDNAQKKFRVR
R

Enzyme Prediction     

No EC number prediction in MGYG000002898_01415.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	209	345	1.9e-22	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11671	mltC	0.0	2	360	1	359	membrane-bound lytic murein transglycosylase MltC.
cd16893	LT_MltC_MltE	3.72e-87	195	355	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
pfam11873	DUF3393	7.09e-82	34	192	1	161	Domain of unknown function (DUF3393). This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 188 to 206 amino acids in length. This domain is found associated with pfam01464.
COG0741	MltE	2.01e-46	51	355	1	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK15470	emtA	4.96e-46	189	353	35	199	membrane-bound lytic murein transglycosylase EmtA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV63049.1	3.73e-263	1	361	1	361
QOR08828.1	8.97e-234	2	361	1	359
CBW15025.1	8.97e-234	2	361	1	359
QOR25488.1	1.27e-233	2	361	1	359
QOR14308.1	1.27e-233	2	361	1	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	1.55e-125	25	360	3	341	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	4.43e-125	25	360	3	341	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
6GI4_B	7.80e-38	189	353	18	182	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]
2Y8P_A	2.15e-37	189	353	18	182	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	2.77e-37	189	353	35	199	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5UHR5	6.61e-225	2	361	1	357	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=mltC PE=3 SV=1
Q4QMD8	2.69e-224	2	361	1	357	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=mltC PE=3 SV=1
P44049	3.82e-224	2	361	1	357	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mltC PE=3 SV=1
A5UDW4	1.27e-222	2	361	1	357	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=mltC PE=3 SV=1
Q9CLB8	1.18e-202	2	361	1	358	Membrane-bound lytic murein transglycosylase C OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000051	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002898_01415.