CAZyme Information: MGYG000002898_00066

Basic Information

• Species: Haemophilus_D pittmaniae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D pittmaniae
• CAZyme ID: MGYG000002898_00066
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000002898_1|CGC1	37452.87	10.0292

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002898	2077686	MAG	United States	North America

• Gene Location: Start: 75188; End: 76240 Strand: -

Full Sequence      

MTKKLLVMAGGTGGHVFPALAVAAELQKQGWEICWLGTKDRMEAQLVPQHGIPIRFIQIS
GLRGKGVKALLLAPFAILRAVLQARAIIRDYQPNAVLGMGGYVSGPGGIAAKLCGVPVIL
HEQNAVAGLTNKWLAKVAKRVLQAFPGAFTDAQVVGNPVRQSLFEMAPPAQRFAMRQGKL
RLLVVGGSQGARVLNQTLPKVVAALGDKLEVRHQVGKGALQSVRDWYGENADKVQLSEFI
NDMAEAYAWADLVICRSGALTVCELAAVGTPAIFVPFQHKDQQQYLNAKYLADAGAAMIV
PQNELSPERLIGLLSDLDREKLAKMAEKAKAKAAPQAASDVAKIVIDCAN

Enzyme Prediction     

No EC number prediction in MGYG000002898_00066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	182	337	4.9e-53	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.87e-172	3	320	2	326	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
TIGR01133	murG	4.88e-150	3	320	1	321	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
cd03785	GT28_MurG	9.59e-144	4	317	1	321	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.39e-143	3	320	1	324	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam03033	Glyco_transf_28	5.26e-56	5	143	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV78346.1	1.60e-247	1	350	1	350
QOR23672.1	2.47e-196	1	350	1	350
QOR07308.1	4.98e-196	1	350	1	350
QOR05470.1	7.06e-196	1	350	1	350
QOR09169.1	7.06e-196	1	350	1	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	3.73e-146	3	342	7	347	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	1.11e-97	1	350	1	356	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	2.62e-93	3	345	10	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P57817	1.73e-184	3	350	6	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=murG PE=3 SV=1
Q65RY6	1.14e-180	3	350	5	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=murG PE=3 SV=1
P45065	6.29e-177	3	350	4	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=murG PE=3 SV=1
A5UCW8	1.27e-176	3	350	4	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=murG PE=3 SV=1
A5UIR2	1.27e-176	3	350	4	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002898_00066.