CAZyme Information: MGYG000002895_00767

Basic Information

• Species: Lawsonella clevelandensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Lawsonella; Lawsonella clevelandensis
• CAZyme ID: MGYG000002895_00767
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		41050.17	5.9182

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002895	1578228	MAG	United States	North America

• Gene Location: Start: 4863; End: 6050 Strand: -

Full Sequence      

MTTKPLSVVVAGGGTAGHIEPAMAVADALTALDPSIRITALGTERGLEKDLVPARGYDLR
MIEAVPLPRRVTAELFRVPGRLTRSVKQARAIMDEVEADVLIGFGGYVSMSAYLAARKGR
RHIPYVVHEANARAGIANKIGARHANRILGAVSGCGFPIEVVGIPVRPAITQLDRVALRQ
EAREFFGLDQDAPVLLEFGGSQGAQSLNRVMHEALPGLAEKNIGVLQAVGPKNYSCADPA
LGGAPDGAEDLLLPAGIIARNVAPTGAPAQVQVPYISAMNLAYAAANLVICRSGAMTVAE
ISAVGLPALYVPLPIGNGEQALNAQPVVEAGGGILIGDHDLTPQQVIEWADELLTTPDKY
QAAVAGAFSAGSRNAADAVARAACELVDYPLPTGH

Enzyme Prediction     

No EC number prediction in MGYG000002895_00767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	195	370	5.8e-38	0.9554140127388535

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.62e-117	5	374	1	342	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	5.11e-101	7	374	1	342	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	3.27e-88	7	374	2	339	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	1.21e-86	8	374	3	342	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam03033	Glyco_transf_28	1.09e-33	8	149	1	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALE35113.1	3.17e-279	1	395	1	395
VHO01635.1	3.17e-279	1	395	1	395
ALE19437.1	3.17e-279	1	395	1	395
QZT65601.1	2.27e-138	4	386	12	374
QZT71427.1	1.30e-137	4	386	12	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	3.29e-42	1	363	2	337	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	5.03e-35	7	358	4	326	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	2.29e-30	3	356	7	332	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1TAW8	5.14e-137	8	386	32	390	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1) OX=350058 GN=murG PE=3 SV=1
A3Q1L8	5.66e-132	6	386	5	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Mycobacterium sp. (strain JLS) OX=164757 GN=murG PE=3 SV=1
Q73YQ8	3.68e-131	4	386	30	393	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) OX=262316 GN=murG PE=3 SV=1
A1UI54	4.59e-131	6	386	5	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Mycobacterium sp. (strain KMS) OX=189918 GN=murG PE=3 SV=1
Q1B6X1	4.59e-131	6	386	5	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Mycobacterium sp. (strain MCS) OX=164756 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002895_00767.