CAZyme Information: MGYG000002895_00506

Basic Information

• Species: Lawsonella clevelandensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Lawsonella; Lawsonella clevelandensis
• CAZyme ID: MGYG000002895_00506
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255		28384.93	6.4839

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002895	1578228	MAG	United States	North America

• Gene Location: Start: 8228; End: 8995 Strand: +

Full Sequence      

MKIVRRLVVALLVLMCAVGVGFAAWVFQDWDTTKYMDEQVPGEFAPAPGVATNAPGQTSD
QLMEWSQRWAPQLGFSARALRAYGNAEQTLKQTMPACHLRWTTLAGIAFIESQHGTYGGA
EVFADGTTSQKIRGVQLDGTNNTQRIQDTDRGVLDGNSHYDVAMGPFQFIPETWRHFGVD
ANGDGRVSPDNIDDAAVAAGRYLCFNGRDLLVPREWQRAILSYNRAMTYVKAVYRSAYAY
GEGRQPRWDYLAAQF

Enzyme Prediction     

No EC number prediction in MGYG000002895_00506.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	100	239	1.4e-17	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	9.23e-25	97	237	1	106	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG2951	MltB	1.82e-23	5	240	24	275	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
pfam13406	SLT_2	7.04e-08	163	203	155	196	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
cd16894	MltD-like	4.17e-04	163	231	30	94	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	0.006	163	245	24	101	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VHO00011.1	9.88e-192	1	255	1	255
ALE19584.1	7.13e-184	15	255	1	241
QXQ15933.1	2.74e-72	41	243	42	244
QIV85448.1	5.45e-72	41	244	19	222
VDR37417.1	1.95e-71	41	246	37	242

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.977746	0.013710	0.007926	0.000083	0.000047	0.000507

TMHMM  Annotations     

start	end
7	26