CAZyme Information: MGYG000002890_00614

Basic Information

• Species: Streptococcus oralis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus oralis
• CAZyme ID: MGYG000002890_00614
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1567	MGYG000002890_51|CGC1	173415.01	5.0011

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002890	1541311	MAG	United States	North America

• Gene Location: Start: 2248; End: 6951 Strand: +

Full Sequence      

MKDLFFEKRCRYSIRKLSIGACSLMIGSALFVSPALAEQVAVPETAANTSAQATSASETA
NPDTVALEKQLEETENKVAEQPISENTPAITDLVNEKEEAKPAPADKAEKPAQPTEKEEV
KPEEVPQVAEKKADKPTLADVPKNEEKSLRPKEIKFDTWEDLLKWEPGAREDDPINRSSV
ELAKRHRGQLVNEKASRRAKVQALANTNSKAKDHASVGGEEFKAYAFDYWQYLDSMVFWE
GLVPTPDVIDAGHRNGVPVYGTLFFNWSNSIADQEKFAAALKQDEDGTFPIARKLVDLAK
YYGFDGYFINQETTGELVAPLGEKMRQFMLYTKEYAAKVNHPIKYAWYDAMTYKYGRYHE
DGLGDYNYQFMQKEGDKVPADQFFANFNWNKEKNDHSVEMAKWLERSQYDVFAGLELQQG
GSYKTKVKWDALLDEKGKLRLSLGLFAPDTITSLGKTGEDYHKNEDIFFTGYQGDPTAQK
PADKEWYGIANLVADRTPAVGRTFTTSFNTGHGRKWFVDGKVSKDSEWNYRSVSGVLPTW
RWWQTSTGEKLRAEYDFTDAYNGGNSLKFSGDVVGKTDQDVNLYSTKLEVTENTKLRVAH
KGGKGSKVYMAFSTTPDYKFEDAAAWKELTLSDNWKNEEFDLSSLAGKTIYAVKLFFEHE
GAVKDYQFNLGQLTISDNHQAPQAPTGLSVVKQSLKNAQEAEAVVQFAGNQDADFYEVYE
KDGDNWRLLTGSSASTIYLPKVSRSANATGRTQELKVVAVGKNGLRSEAATASFNWGMTV
QDTTLPRPLAENIVPGAKVIGSTFQNTEGGEGIEGMLNGTITSLSDKWSSAQLSGSVDIR
LTKPRTVVRWVMDHAGAGGESVNDGLMNTKDFDLYYKDTDGEWKLAKEVRGNKAHVTDIT
LDKPITAQDWRLKVITSDNGTPWKAIRIYNWKMYETLDTESPNIPMAKVAARSLGNHQVQ
LGFSDVPVGATITVYDKADSQIPIATLKSETGGDLATAPLGFDKQPTLLYYRTQLPGKEI
SNTLAVAIPQDERKIAAVSLEKGPKKTVYKEGEKLDLRGGTLRVQYEGGQADELINLTHS
GVTVSGYNAHQKGEQKLTVSYLGLPVSGDLKVQVTGQDEGKPKEVAGLYITQKPKTDYLV
GEQLDLAEGRFGVLYDDETEESHAFTDQGVEITGYDAQKTGRQTLTLQYKGHTAPKAAVN
DEYLKQEITAAQGRQSTLAYTFSSEDKQTALVEKLNAAKAVAENHNASQEEVNRALNELK
QAGTALDGNQRYQTAREELEGLLESVREKDPKAELIEQAETLLASEMPTPQAFADMKEKL
NKKLAPAEESHHVGSMDPNEVAPTVEALPELVIETETTAYERQERPNSEFLKGQRRVVQA
GVEGQVRLFVEVDAQGKRTLHSTEVVKEAIPEITEVGTKVLSSNQPAEGVKDLVLATPKL
EVEEGTVSFEHQERPNAALLKGQRQLVQAGVEGQVRRFVEVDAQGKRTLHSTEVLKEALP
EIVEVGTKEDQVSQTRDQALSVAPAKVEEVSKELPNTGATRDASLVALGLLGVMSGYGLL
ARKKRED

Enzyme Prediction     

EC	3.2.1.96

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	208	517	1.8e-110	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4724	COG4724	0.0	160	679	37	553	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
pfam03644	Glyco_hydro_85	3.87e-104	218	513	1	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
cd06547	GH85_ENGase	4.77e-93	213	548	13	339	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
pfam07501	G5	1.34e-10	1350	1419	2	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam07523	Big_3	8.60e-10	1043	1114	1	67	Bacterial Ig-like domain (group 3). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA08589.1	0.0	1	1567	1	1574
QLL96936.1	0.0	1	1567	1	1574
VEF79601.1	0.0	1	1567	1	1574
ATF56097.1	0.0	1	1567	1	1574
QQL00520.1	0.0	1	1567	1	1574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W91_A	0.0	147	795	5	653	Structureof a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	0.0	123	928	132	937	Crystalstructure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]
2VTF_A	2.39e-86	160	739	19	588	X-raycrystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
2XQX_A	1.20e-85	790	935	5	150	Structureof the family 32 carbohydrate-binding module from Streptococcus pneumoniae EndoD [Streptococcus pneumoniae TIGR4],2XQX_B Structure of the family 32 carbohydrate-binding module from Streptococcus pneumoniae EndoD [Streptococcus pneumoniae TIGR4]
3FHA_A	1.33e-85	160	739	14	583	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49610	2.84e-24	1332	1564	1047	1311	Beta-N-acetylhexosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=strH PE=1 SV=2
Q8BX80	6.70e-20	212	615	129	506	Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Engase PE=1 SV=1
P0C7A1	1.15e-19	160	573	89	463	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1
Q8NFI3	1.94e-16	148	615	79	514	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002530	0.990154	0.006575	0.000291	0.000232	0.000204

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002890_00614.