CAZyme Information: MGYG000002889_02895

Basic Information

• Species: Pantoea sp002920175
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea sp002920175
• CAZyme ID: MGYG000002889_02895
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000002889_26|CGC2	43831.22	6.5926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002889	4513078	MAG	United States	North America

• Gene Location: Start: 41288; End: 42463 Strand: -

Full Sequence      

MNFRCLFLCLGLAVWSQLALAIPLPQRPPDTLPPERYISHVNANNTITWQLWAPAAKAVE
VVTGATPDRYVSHPMTKDDQGIWSFTSEPLQPSLYEYFFNVDGFRSVDTGNALAKPQRQV
NTSLILVPGSLLDEREVPHGEIHTLTWHSPSLKRERRIAVWVPPGTRADSPPLPVLYYYH
GFGDTGMSVLTQGRVPQIMDNLLAEGKIEPMLVVMPDTETDAEGAIPESFVPATRREVFY
PRNAQAADKELMEEIMPLVAARYPVRKEASGQALAGLSQGGYQALVSGMRHLDKFAWLGI
FSGVTTETVPDFRVAAQLKKPTAINRQLKLLTLVSGEEDIITGRDMTGLKAQLDQRGIRN
DWHSYPKLGHEMDVWRPAYIDFVQKLFRTEK

Enzyme Prediction     

No EC number prediction in MGYG000002889_02895.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	149	384	7e-42	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	6.10e-66	73	389	5	298	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	8.26e-27	45	128	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	8.56e-17	149	381	1	241	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
cd02858	E_set_Esterase_N	1.12e-12	45	108	1	59	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG0627	FrmB	4.15e-12	142	383	25	305	S-formylglutathione hydrolase FrmB [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01057.1	5.97e-60	41	388	45	384
BBL06292.1	9.52e-58	36	389	48	393
QDT66419.1	2.73e-57	41	388	47	382
AUD00500.1	1.35e-54	4	387	3	373
BCS41279.1	7.53e-54	41	388	40	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7B5V_A	3.61e-39	43	388	44	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	1.13e-37	27	388	5	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	1.15e-37	27	388	5	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZN_A	1.88e-37	23	388	4	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6NE9_A	3.89e-30	27	388	30	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31471	1.64e-168	1	388	1	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EXZ4	1.04e-29	30	388	320	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	1.80e-24	41	388	397	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	6.45e-24	123	384	30	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000207	0.999235	0.000147	0.000150	0.000129	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002889_02895.