CAZyme Information: MGYG000002877_00313

Basic Information

• Species: Prevotella sp900550365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900550365
• CAZyme ID: MGYG000002877_00313
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
858	MGYG000002877_3|CGC2	96955.53	5.7749

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002877	2502849	MAG	United States	North America

• Gene Location: Start: 77943; End: 80519 Strand: +

Full Sequence      

MKHFTLTVCLLALLSFATSSNAAERFVDFTSGDILLNAGGKTTIYIDPADCKGVSIAAAN
LAADINKVCGAVTATTGQADGAVIIAGTIGHSAGIDRLVKEKVINKADLKGKREKYIITT
AGGKLVIAGSDRRGTIYGIYELSRQIGVSPWYYWADTPVERHERIYINKGIYTDGEPVVR
YRGIFLNDEAPCLTTWVKNTFGTDYGNHEFYSKVFELILRLKGNFLWPAMWSWAFYADDP
LNGKTADEMGVMIGTSHHEPMARNHQEWARNRDKYGQWNYETNREVIDRFFREGIERARG
TEDVITIGMRGDGDAPMGGEEGKDHEYVPQYEKNMKLMQTIIRNQRDIISDVTRRPAKET
PQVWALYKEVLEYYDRGLEVPDDVTLLLCDDNWGNVRRVPKADERQRKGGWGLYYHVDFV
GAPRNSKWLNCTQPQGMCEQLTLAYDYGIDRLWILNVGDLKPMEYPISLFMDMAWNPRKY
TPVSVTGHLKEFCAQQFGESQADEAARIINLYLKYNARVTPEMLDRNTYNVETGEWQRVA
DEYVRLEAEALRQYVSLPEAYRDTYFQIVLFPVQAMSNLYQMYYAQAMNHYLYGLGDADA
NLWADRAEKAFRRDSLLCAQYNHDIAGGKWNGMMIQKHIGYTGWNDDFDKDTMPAVMRTG
VATEGGYTHRGSNGYVAMEAGDWFEKHDGTEATWTYIPYIGRTDGGMALTPYTAATDGGR
LTYRFTLPADDIPADGKVKVHVVVKSTLDFLNKGGLCYSVALDGGKPERINFNHNLNDKP
ENTYTVYYPTVARRVVESTVTLPISGTEGNIHELTITPEDPGIVFEKIVIDYGGYRPSYL
FMKASEKTAGGTAEMKKP

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	36	828	2.4e-275	0.9899569583931134

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	175	523	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	6.92e-32	672	840	5	168	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.008	73	142	53	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG34758.1	0.0	34	847	1	800
BCS85271.1	0.0	22	845	21	828
QNT66545.1	0.0	12	834	15	844
AGB29053.1	0.0	22	841	28	827
QCD34650.1	0.0	18	845	29	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	22	846	30	850	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	0.0	35	845	19	834	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	0.0	35	845	18	833	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	1.49e-164	43	649	24	625	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	9.33e-118	27	651	3	652	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000236	0.999100	0.000152	0.000191	0.000169	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002877_00313.