CAZyme Information: MGYG000002874_01237

Basic Information

• Species: UBA1777 sp002320035
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA1777; UBA1777 sp002320035
• CAZyme ID: MGYG000002874_01237
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
795	MGYG000002874_14|CGC1	87189.09	7.9883

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002874	2306396	MAG	United States	North America

• Gene Location: Start: 28829; End: 31216 Strand: -

Full Sequence      

MKHEKLISQMTPEEKASLMSGKNFWHTKSVDRLGVPSMMLTDGPHGLRKQAGKSDNLGLN
RSVPATCYPTAAALANSWDEEMLELLGERLGLEAASEQVSVLLGPGVNIKRNPLCGRNFE
YFSEDPFLSGRAGAALIRGIQRNGVAACVKHFAANSQELLRMSCDSVLDERTLREIYLPA
FEAAVKEGGVGCLMSSYNPVNGVYANENRHLLRDILYNEWGYRGMVVSDWGGNNDRVAAI
RAGSTLEMPSSFGETDRHIVSAVRDGSLPEALLDEQVDRLLETLFSTRPALAGKSYDKAA
HHAFAARAAEETAVLLKNEGGFLPLKPGRRVAVIGSFAQKPRYQGAGSSLINPTRLETPL
EALKAEGVNVIGFAPGFRRFGGESRTLRREALALAERADVVLLYLGLSEADDAEGVDRPH
MRLPENQIRLLREISGVNSSVAVVLSCGCAVEMDWDIYVPALVHGYLGGQAGAVAMARLL
TGKANFCGKLAETVPLRYEDVPSAAYYPGREKSAEYREGLYVGYRYYESAGVNVKYPFGH
GLSYTSFAYSDIRADENGVSFLVKNTGSRAGAEVAQVYVAPPAGGIFRPAMELRGFSRVS
LAPGEEKRLRIPLTERSFSLWNIRENRWSVEPGEYQILVGASCRDIRLRASVVKTGPAVE
NPYQGQEFAPYYRADIKAVPDESFRALLGHEPPAAYWDRSVPLGFNDTVYQGSYLKGGLG
RFLYEALAGYVRVMTAAGRPDRANEAAFYMNMPYRNLGRLSGLFSDRQMQALLRVVNRER
GGLGGFIKEMCHNRG

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	249	7.3e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.22e-73	32	640	101	751	beta-glucosidase BglX.
COG1472	BglX	1.60e-57	22	368	47	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.11e-55	314	524	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	3.72e-51	6	611	56	740	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.95e-33	32	282	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK48658.1	4.34e-300	1	792	1	791
ANY69910.1	2.31e-294	1	792	1	790
QHZ46306.1	3.05e-294	1	792	1	790
AZK49185.1	3.39e-293	1	789	1	794
BAM48418.1	3.89e-293	1	792	1	790

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	9.07e-220	4	652	6	666	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.56e-188	7	656	9	665	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.02e-123	2	651	3	710	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.56e-122	2	651	3	710	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	6.63e-97	4	646	7	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	4.97e-219	4	652	6	666	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.00e-181	7	679	9	702	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	3.98e-181	7	679	9	702	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	9.16e-122	7	647	50	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q2U8Y5	1.97e-119	4	639	7	816	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002874_01237.