CAZyme Information: MGYG000002857_00009

Basic Information

• Species: Hydrogeniiclostridium sp900550095
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Hydrogeniiclostridium; Hydrogeniiclostridium sp900550095
• CAZyme ID: MGYG000002857_00009
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751	MGYG000002857_1|CGC1	85079.18	5.8724

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002857	2686801	MAG	United States	North America

• Gene Location: Start: 7436; End: 9691 Strand: +

Full Sequence      

MAIYVEKNAGGETLFTLETKASTYQMKADTYGYLLHLYYGDRIGREDTGYLLHREDRGFC
ACPNDLERDRTYSLDCQPQEYPAAGAGDFRAPCIAAEFENGGKTLDLRCASHRMLEKKPG
LPGLPALYETKENEAETLEICLKDSAEELYVYLLYSVFEKEDAIARSCRVENRTGKRVFL
NAALSACMDINGDEELDLISFWGRHCMERNVERRPVSHGKTVIDSIRGTSSAQQNPFVIL
CDHDATEDFGRCWGLSLVYSGNFAAVAEKNQLSLTRLTMGLNPENFRWRLLDGESFQAPE
AVFCYSPAGLTALSQKYHRLYRENLCRGYWKDRRRPVLINNWEATYFHFDTEKLVKIAET
AGKLGVELLVMDDGWFGKRDDDWSGLGDWKVNEKKLPGGMKALCERVNALGMKLGVWFEP
EMVSEDSDLCRAHPDWFLHVPGRGYSRSRYQLVLDFSRKEVRDNIHDQMAAVLSSANIEY
VKWDMNRHLTEVWSAGLPPERQGEVHHRYMLGVYELMERLTSEFPHVLFEGCSSGGGRFD
AGMLYYMPQSWCSDNTDAIERLEIQYGTSFGYPMSSVGAHVSASPNHQTGRTAPFYTRGV
VAMAGTFGYELDLNALTDEERDMVREQVAFYKKNYDTINRGEYYRLTDPAKNREFCAWEY
VSRDKKKALLFGVVTHVRCNVAMPVIRLKGLDPAATYRLSCRAEGRGRAAQAAAAVEGVY
SGSLLMGAGLRLPSLRGDWPSFCAELEEGAR

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	14	730	4.6e-268	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3345	GalA	0.0	12	751	1	685	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	0.0	295	641	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	1.17e-147	334	633	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	3.36e-106	32	290	1	255	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	7.46e-21	656	741	2	73	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN32673.1	5.20e-293	3	747	4	729
AWY99332.1	6.05e-281	14	698	9	689
BCK01162.1	9.88e-278	1	742	1	720
AEC02289.1	3.33e-267	1	732	1	713
QUO31118.1	1.13e-266	12	748	7	728

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNQ_A	5.97e-250	15	747	12	725	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	3.15e-247	15	747	12	725	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2YFN_A	4.64e-247	1	742	1	713	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
4FNU_A	2.91e-245	15	747	12	725	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNT_A	4.12e-245	15	747	12	725	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ALJ4	1.73e-246	15	747	12	725	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G4T4R7	7.86e-244	1	751	1	725	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
G1UB44	8.19e-211	14	739	14	721	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	1.24e-207	14	698	12	693	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
P27756	9.31e-163	12	741	7	712	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002857_00009.