CAZyme Information: MGYG000002839_00210

Basic Information

• Species: Granulicatella sp001058355
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Aerococcaceae; Granulicatella; Granulicatella sp001058355
• CAZyme ID: MGYG000002839_00210
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000002839_2|CGC1	55791.04	4.925

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002839	1704884	MAG	United States	North America

• Gene Location: Start: 41774; End: 43219 Strand: +

Full Sequence      

MDKKQRILWGGATASSQYEGGFTDSKGLDTQDCRAYLPRTSNATEETRLLTKEKIEEAKR
LDSGKYYPFRNGTKGFEHLEEDIEYLDELGLDLYRFSISWARLFPNGVEEVPSPEGVAYY
DRVFNLLTEKKIKIFLTLNHYAMPIYLVEQYGGWKGRECIEHFMRFATFVFERWGNLVEY
WLPFNEINAGYFSPYNGVGLLKGENGFDLTDVFQALHHQFVASAKTIKLAREMKLPGRFG
SMIACFCYYPLTSRPEDNLKLVFEEQMNQWYCMDILSKGEYPYYAETFFKNKNIVLNITD
EDKKLLRENTCDFVSISFYTSSVITMEEADKTAGNLVVSTKNPYLKASEWGWQIDPVGLR
TSLHKVYERYGKPVIVSENGLGARDVLTENGEVHDEYRIDYMKSYYEQAQLALEDGVPLE
AYIAWGIIDIVSAGSCEMDKRYGVIYVDADNLGNGSYKRYKKDSFYWYKDFIQKYKEENN
G

Enzyme Prediction     

No EC number prediction in MGYG000002839_00210.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	474	1.4e-120	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	5.79e-151	8	481	9	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	8.10e-146	5	472	6	466	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	4.57e-140	8	472	11	470	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	1.11e-133	4	478	5	475	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	5.44e-120	8	472	11	470	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGR82556.1	6.57e-250	7	477	4	476
AYY09186.1	6.57e-250	7	477	4	476
QCT91134.1	6.57e-250	7	477	4	476
QOG28866.1	9.33e-250	7	477	4	476
QTU83297.1	9.08e-245	5	476	2	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.14e-128	7	473	12	463	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	2.77e-114	7	473	24	479	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	6.87e-113	7	472	12	472	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3QOM_A	3.67e-110	7	472	15	473	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	7.91e-106	5	472	9	473	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	2.74e-129	7	472	12	462	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	5.33e-125	5	472	6	466	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P26206	5.66e-125	7	472	9	456	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P11988	3.01e-123	5	473	6	456	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
Q46130	6.61e-123	7	472	11	464	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002839_00210.