CAZyme Information: MGYG000002835_01471

Basic Information

• Species: Fusicatenibacter sp900543115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Fusicatenibacter; Fusicatenibacter sp900543115
• CAZyme ID: MGYG000002835_01471
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1015	MGYG000002835_26|CGC1	116692.87	4.683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002835	2863124	MAG	United States	North America

• Gene Location: Start: 27505; End: 30552 Strand: +

Full Sequence      

MLVPRYYEDLSVLHLNTMPNRAYYIPASVSMDTVGEKREGSDRFVLLNGDWKFRYYESIY
DLKDAFYEEGFCTCGFDEIPVPSVWQNHGYDRHQYTNVRYPFPLDPPYIPQDNPCGAYVH
KFEYQKQADAPKAYLNFEGVDSCFYVWLNGTFVGYSQVSHSTSEFDVTPYLKDGENTLAV
LVLKWCDGSYLEDQDKFRMSGIFRDVYLLLRPEQGIFDYFLKAVPSKDYKDGTIDVEFKF
MDGEVPVNCRLLDVCGNLVAEQKAVDGKVHMEVKDAHLWNAEEPYLYTIIYETEHEVITD
HVGIREIHIEGNVVYLNGQKIKFHGVNRHDSDPVTGFTISQEQIMKDLVLMKEHNVNAIR
TSHYPNAPHFYELYDAMGFYVIDEADNESHGTSMRYIESMDWETIRKLWNEMIADNPDYT
ESTVDRTQRCVERDKNRPSVVIWSMGNECAYGCTFEAALEWTKKFDDTRLTHFESALHVS
DKRKYNFDNIDLFSRMYPALEEIHEYVNEDGRKPFVMCEFCHAMGNGPGDLEDNFRLIQQ
YDGVCGGFIWEWCDHAIDMGKTIEGRKMYAYGGDHGEYPHDGNFCMDGLVYPDRRVHTGL
LEFKNVYRPARVVSYDQNSGELVLHNYMDFLNLKDYLTVSYEVLCDGTVIAKGTVENQAL
LDIPAHEEGTMTLPVDVPEKGKAALKISYALKDARGVLPAGFALGFDEVALKTAENENQK
VKTLLADGTAPAPKAEEEDASVIVSGDNWRYVYNKRTGLFAQMVYENQNLLEQPMEFNIW
RAPTDNDRNIKREWMRAQYDRTFDRAYNTTVTEKDGCIVIESDLSVAAIYAQRILEIHAV
WTVSGDGAVDVHLDVTRTPNFPFLPRFGLRLFLPKSMQKVTYCGIGPNESYKDKRQSGYH
GLFHTDVPGLHEDYIRPQENGAHDDCDYVILENDHLALAAAGAKTFAFQASEYTQEELTR
KAHNYELEKSPYTVLCLDYCQSGIGSNSCGPELREEYRLNEENFTFAIRLKPEAK

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	35	898	1.9e-208	0.9694148936170213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	39	1013	47	1027	beta-galactosidase.
PRK10340	ebgA	0.0	7	1012	4	999	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	6.56e-139	47	898	15	804	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	6.78e-90	307	609	1	299	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	6.02e-84	745	1010	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE95754.1	0.0	1	1015	1	1028
QMW76342.1	0.0	1	1015	1	1028
QIB55792.1	0.0	1	1015	1	1028
ANU77954.1	0.0	1	1015	1	1028
QQQ91285.1	0.0	1	1015	1	1028

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	3.05e-188	3	1011	1	981	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	4.18e-188	4	1011	1	980	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6ETZ_A	6.25e-158	47	1011	39	986	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]
6SEB_A	1.07e-157	47	1011	60	1007	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB in complex with IPTG [Arthrobacter sp. 32cB],6SEC_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cBon complex with ONPG [Arthrobacter sp. 32cB],6SED_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with galactose [Arthrobacter sp. 32cB]
6ZJP_A	2.96e-157	47	1011	60	1007	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant E517Q [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70753	2.05e-309	1	1010	1	997	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
O33815	1.03e-250	1	1011	1	992	Beta-galactosidase OS=Staphylococcus xylosus OX=1288 GN=lacZ PE=3 SV=1
Q56307	1.67e-187	3	1011	1	981	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P06864	6.19e-178	7	1012	4	999	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
O52847	3.66e-173	4	1012	18	1033	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002835_01471.