CAZyme Information: MGYG000002827_03738

Basic Information

• Species: Phyllobacterium sp900539805
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales_A; Rhizobiaceae_A; Phyllobacterium; Phyllobacterium sp900539805
• CAZyme ID: MGYG000002827_03738
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	MGYG000002827_36|CGC1	43073.77	9.0363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002827	5102924	MAG	Singapore	Asia

• Gene Location: Start: 7694; End: 8965 Strand: -

Full Sequence      

MVKNKFALLGFGVVVAVGLAAAYLGFVPGKPTSNTPAVTASGNAPAPAAQTPAAKPAEQP
QAAPSTDTTAPAAAPAAGTTTPQVEAAEGKPGAPTFDVLRVDPKGTIVLAGKAANNAKVD
LLARGDILGTTKASPNGDFVIVLDDPLKPGDYQLVLRSTAPDGSAMTSLETAIVSIPETK
SGQVLALVEQSGQPSRLITVPEAPAGQAASNQPAAAAAPTGDKPAKQPAAKARIVVEAVE
IEGSKLFIAGIADAGYTVKVYANDNLIGSTKTGADGHFLVQTTRDLPVGDYIIRADMVEK
DGVTVIARAAVPFKREAGQRVSAVAPSATPAPAATAQASTEAAPAAGSEQASGADTAKPL
RNVDGSVIIRRGDNLWTISRRTYGAGVRYTTIYLANKEQIQNPNRIFPGQVFSLPEKDKP
APQ

Enzyme Prediction     

No EC number prediction in MGYG000002827_03738.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1652	XkdP	5.89e-26	186	420	1	267	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
PRK11198	PRK11198	1.33e-12	367	416	98	147	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	3.71e-06	366	411	2	42	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	3.94e-05	367	415	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
NF033163	lipo_LipL71	8.27e-05	373	420	416	465	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATU92178.1	5.32e-165	1	423	1	430
QPA28979.1	9.55e-103	1	417	1	412
QFP62328.1	9.55e-103	1	417	1	412
QOD64070.1	9.55e-103	1	417	1	412
AWC24745.1	2.11e-102	93	419	75	434

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FIM_A	1.74e-06	369	417	101	149	Thestructure of Kbp.K from E. coli [Escherichia coli],7PVC_A Chain A, Potassium binding protein Kbp [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0ADE6	8.29e-06	369	417	101	149	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2
P0ADE7	8.29e-06	369	417	101	149	Potassium binding protein Kbp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=kbp PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.985534	0.013743	0.000385	0.000109	0.000053	0.000202

TMHMM  Annotations     

start	end
7	29