CAZyme Information: MGYG000002827_03403

Basic Information

• Species: Phyllobacterium sp900539805
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales_A; Rhizobiaceae_A; Phyllobacterium; Phyllobacterium sp900539805
• CAZyme ID: MGYG000002827_03403
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
156	MGYG000002827_29|CGC2	17237.84	9.6014

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002827	5102924	MAG	Singapore	Asia

• Gene Location: Start: 43144; End: 43614 Strand: +

Full Sequence      

MHRASSKYDIPIGILYAVGLTETGRKDSLQPYAMNIEGKAVFMPSAAAAVMKFNEAHGQG
AKLIDLGCMQINHYFHASAFPSVGAMLDPATNVDYAARFLKQLRAREGNWTMAVARYHAG
PNNNPAQKQYVCRVMENMVASGFGNWTQKARMFCDK

Enzyme Prediction     

No EC number prediction in MGYG000002827_03403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	14	140	7.6e-21	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	4.64e-16	8	137	1	106	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	8.73e-10	1	125	111	245	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	6.47e-08	67	138	26	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	8.89e-08	79	139	65	147	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	4.35e-06	65	123	35	98	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QND50654.1	1.37e-106	1	156	41	196
ATU95885.1	1.34e-104	1	156	1	156
ANG97104.1	7.31e-91	1	154	33	186
ASV84799.1	1.00e-90	1	154	1	154
QWK79801.1	2.09e-90	1	154	33	186

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002827_03403.