CAZyme Information: MGYG000002825_02923

Basic Information

• Species: Klebsiella_A indica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A indica
• CAZyme ID: MGYG000002825_02923
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
197	MGYG000002825_11|CGC3	21514.8	7.9998

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002825	5145656	MAG	Singapore	Asia

• Gene Location: Start: 163795; End: 164388 Strand: +

Full Sequence      

MFLLVLLAGCSSKQDYRNPPWNPEIPVKRAMQWMPVSEKAGAAWGVDPQLITAIIAIESG
GNPTVISQSGAVGLMQLKPSTSGRDVYRRMGWSGVPSVSELKNPERNISMGAAYLSILET
GPLAGIKDPQVMRYALVVAYANGAGALLRTFSSSRQDAIDEINEMDADDFFEHVVKKHPA
PQAPRYIWKLQKALDAM

Enzyme Prediction     

No EC number prediction in MGYG000002825_02923.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	32	192	1e-17	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15470	emtA	3.55e-145	1	197	7	203	membrane-bound lytic murein transglycosylase EmtA.
cd16893	LT_MltC_MltE	3.82e-78	38	193	4	160	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	2.57e-57	28	193	187	352	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	1.91e-31	39	162	3	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	8.43e-30	16	195	122	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS42310.1	1.23e-135	1	197	7	203
AVL83174.1	1.23e-135	1	197	7	203
APB44121.1	1.23e-135	1	197	7	203
AWF35985.1	1.23e-135	1	197	7	203
AKL26383.1	1.23e-135	1	197	7	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3T36_A	1.81e-111	11	197	17	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
4HJY_A	5.75e-111	11	197	20	206	2.4A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJY_B 2.4 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_A 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_B 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12]
2Y8P_A	2.19e-110	13	197	2	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHY_A	6.27e-110	13	197	2	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	6.27e-110	13	197	2	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5XQ85	3.22e-132	1	197	7	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=emtA PE=3 SV=1
A6TAW0	9.23e-132	1	197	7	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=emtA PE=3 SV=2
B5R901	1.57e-123	2	197	8	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=emtA PE=3 SV=1
C0Q334	1.57e-123	2	197	8	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=emtA PE=3 SV=1
Q5PN08	1.57e-123	2	197	8	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000047	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002825_02923.