CAZyme Information: MGYG000002818_01001

Basic Information

• Species: Tissierella sp002266425
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Tissierellaceae; Tissierella; Tissierella sp002266425
• CAZyme ID: MGYG000002818_01001
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261	MGYG000002818_6|CGC1	28938.97	9.7726

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002818	4155491	MAG	United States	North America

• Gene Location: Start: 56781; End: 57566 Strand: +

Full Sequence      

MKKTTKTVIGTAVLTFCIGTTSLAANHTVAKGDTFWKISQKYGITLESILKENKANQKTM
IYPGQVIKIPERAVNKNAPNRGTVDRVTAEEVVKMQASQEVVQDTTYGEYLNWFTEVDNI
VPRGAKFKVIDFYTGKSYMVQRYIGSNHADCETLTKEDTDIMKSIWGGFSWVRRPAIIEY
NGRRIAASVTFMPHAGLDSVAGGVTANNRSGGYGRGINFDYIKGNGMDGHFDIHFAGSTR
HMDGKQDPEHQKMIKIAAGIK

Enzyme Prediction     

No EC number prediction in MGYG000002818_01001.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	27	70	6.2e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	3.11e-13	27	69	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	8.37e-13	27	69	2	44	Lysin motif.
pfam01476	LysM	5.19e-12	27	70	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
TIGR02899	spore_safA	1.06e-09	29	70	1	43	spore coat assembly protein SafA. SafA (YrbB) (SafA) of Bacillus subtilis is a protein found at the interface of the spore cortex and spore coat, and is dependent on SpoVID for its localization. This model is based on the N-terminal LysM (lysin motif) domain (see pfamAM model pfam01476) of SafA and, from several other spore-forming species, the protein with the most similar N-terminal region. However, this set of proteins differs greatly in C-terminal of the LysM domaim; blocks of 12-residue and 13-residue repeats are found in the Bacillus cereus group, tandem LysM domains in Thermoanaerobacter tengcongensis MB4, etc. in which one of which is found in most examples of endospore-forming bacteria. [Cellular processes, Sporulation and germination]
COG1388	LysM	3.74e-08	27	71	69	112	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT60909.1	5.34e-92	9	260	8	333
ANV75307.1	2.94e-85	26	261	211	423
ALX07567.1	2.94e-85	26	261	211	423
ADU73639.1	2.94e-85	26	261	211	423
ABN54201.1	2.35e-84	26	261	211	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	2.66e-06	25	72	3	49	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HRU2	1.91e-07	2	137	3	135	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	1.91e-07	2	137	3	135	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000424	0.994630	0.004208	0.000247	0.000242	0.000207

TMHMM  Annotations     

start	end
7	29