CAZyme Information: MGYG000002817_03009

Basic Information

• Species: Paenibacillus_B sp900539405
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B sp900539405
• CAZyme ID: MGYG000002817_03009
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		37914.9	5.6358

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002817	6425839	MAG	United States	North America

• Gene Location: Start: 81716; End: 82765 Strand: -

Full Sequence      

MNQLRVWNPLASKVSPLFVAFGAVLAAFFCMMVFAEQASAHGYIESPHSRAYQCKLGENT
NCGLVQYEPQSIEAKGNFPIGGPEDGHIAGGGVFPELDAQSSTRWNKVNMNGGNNTFTWN
LTAPHATKEWKYYITKKDWNPNQPLTRAQLEPDPFCYYNDGGKKPDKSVSHQCSVPTDRS
GYYIILGVWEIADTGNAFYQVIDVNLNNGSGGVAPSVPAGVASPSQTETSISLTWSPSSS
PNGIQQYEVYRNGTLAGTTAQTSYTDTGLTENTSYTYTVRAVDTAGNKSQPSPALTVKTL
GDSGSQYPAWDATKTYVGGDRVSHNGAVYEARWWTSGEEPGQAEVWKKL

Enzyme Prediction     

No EC number prediction in MGYG000002817_03009.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	41	205	4.8e-56	0.9943820224719101
CBM5	307	346	1.6e-18	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	2.90e-90	24	216	7	202	N-acetylglucosamine-binding protein GbpA.
COG3397	COG3397	1.92e-85	17	289	9	292	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
cd21177	LPMO_AA10	1.46e-66	41	205	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	3.23e-57	41	204	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
COG3979	COG3979	8.49e-23	212	346	2	143	Chitodextrinase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM45905.1	1.74e-248	1	349	1	348
AVF28451.1	6.90e-170	1	349	1	348
AQT84704.1	6.90e-170	1	349	1	348
AVF32954.1	6.90e-170	1	349	1	348
AQZ46702.1	6.90e-170	1	349	1	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WSZ_A	8.83e-85	41	208	1	168	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
2BEM_A	8.67e-75	41	207	1	169	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	1.98e-73	41	207	1	169	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
5L2V_A	3.07e-63	41	208	1	166	Catalyticdomain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S],5L2V_B Catalytic domain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S]
6T5Z_A	1.28e-58	41	207	1	172	Crystalstructure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_B Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_C Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8EHY2	1.97e-62	35	210	22	199	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q8D7V4	3.47e-50	31	218	14	208	GlcNAc-binding protein A OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=gbpA PE=3 SV=1
Q7MEW9	6.77e-50	31	218	14	208	GlcNAc-binding protein A OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=gbpA PE=3 SV=1
A5F0H4	1.91e-48	38	225	21	220	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=gbpA PE=3 SV=1
Q9KLD5	1.91e-48	38	225	21	220	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=gbpA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.587956	0.406129	0.004244	0.000674	0.000367	0.000646

TMHMM  Annotations     

start	end
13	35