CAZyme Information: MGYG000002814_00175

Basic Information

• Species: UBA3631 sp900544605
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UBA3631; UBA3631 sp900544605
• CAZyme ID: MGYG000002814_00175
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231	MGYG000002814_2|CGC1	26370.77	9.7586

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002814	1046494	MAG	Peru	South America

• Gene Location: Start: 65202; End: 65897 Strand: -

Full Sequence      

MAKKKRKPLNPIIKILLLIFIAFLVICNVIFYKGYITYQAAINEISIEEKINSIKMQDNY
IKIEDVSKYYKDAVIAVEDHRFYKHKGIDLISTFGALFSNIKTKSLGMGGSTITQQLAKN
MYFSQKKEFTRKVAELFVALDLEKKLTKNEILELYVNIIYFGDGYYGIENASKGYYGKSA
NDLTLEEAIMLAGLPAAPSVYSPNVNKNLANQRYKQVESAMKKYGYLKNEN

Enzyme Prediction     

No EC number prediction in MGYG000002814_00175.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	55	222	3.9e-63	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	7.44e-77	60	222	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	7.92e-74	60	230	4	174	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.91e-68	60	227	78	246	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.39e-58	42	230	59	239	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	1.97e-42	23	230	13	223	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP41835.1	4.29e-68	4	230	2	225
ASN93505.1	4.29e-68	4	230	2	225
QJU22158.1	6.07e-68	4	230	2	225
QOR67159.1	1.43e-67	7	230	3	220
QUO38940.1	1.57e-67	12	230	8	226

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	2.32e-38	60	230	22	192	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	4.02e-38	55	227	36	208	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2OQO_A	6.52e-38	60	230	22	192	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	7.95e-38	49	227	48	232	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	8.36e-38	49	227	12	196	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	3.03e-40	40	227	29	215	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O87626	3.19e-40	60	227	70	237	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P38050	5.63e-39	4	227	5	236	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O05131	1.84e-38	60	221	70	231	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3
P0A0Z5	1.84e-38	60	221	70	231	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.927986	0.013884	0.042845	0.000077	0.000048	0.015184

TMHMM  Annotations     

start	end
13	32