CAZyme Information: MGYG000002807_00631

Basic Information

• Species: Eubacterium_R sp900539165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900539165
• CAZyme ID: MGYG000002807_00631
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		42558.35	8.8642

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002807	1764558	MAG	Peru	South America

• Gene Location: Start: 61065; End: 62177 Strand: -

Full Sequence      

MKKVLFMAINMNVGGTEKSLINLIHEMPSFEYEITVLLLEKSGGYLETLENFDNVTVKEL
NQYSGKRFLIHDSPKDIIKHYLKEKKIIKTFKILVSYIISKVFNNSYFYIRSVVNKFSPD
LGNYDVAVAYAGPMDFISQYIISKVKANIKVQWIHFDVDKICFDKKFANKVYSKFNKVYV
VSESAKTHLLKAVPEIRNFTEVKYNVVSAELCKSLADVGESFNDDFDGVRILTVGRLSKE
KGQDIIPKVINELCKQNINFRWYLIGEGNLKDEIATEIKSMGLEQHLVFLGLRMNPYPYY
KDCDIYVQPSIHEGYCLTLAEAKLFNKIIISTDFSGAREQFENYKNGTIVNNSVESFVDS
IFKNIKKLGK

Enzyme Prediction     

No EC number prediction in MGYG000002807_00631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	231	363	2.5e-26	0.84375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03811	GT4_GT28_WabH-like	1.11e-60	3	365	1	325	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03820	GT4_AmsD-like	5.68e-31	12	361	11	316	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
pfam00534	Glycos_transf_1	1.96e-26	231	361	5	138	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03801	GT4_PimA-like	7.16e-26	3	361	1	327	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03819	GT4_WavL-like	2.31e-23	165	361	117	315	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHE59840.1	1.86e-116	2	365	3	366
AGK52662.1	3.56e-113	2	350	3	349
QWH29824.1	3.16e-112	2	361	3	360
QWH73420.1	1.17e-109	2	361	3	360
QWH18734.1	2.34e-109	2	361	3	360

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0P9C7	3.84e-15	201	368	171	329	N-acetylgalactosamine-N,N'-diacetylbacillosaminyl-diphospho-undecaprenol 4-alpha-N-acetylgalactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglJ PE=1 SV=1
B3LKQ3	1.12e-07	173	365	146	341	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=SPT14 PE=3 SV=1
B5VSZ6	1.12e-07	173	365	146	341	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=SPT14 PE=3 SV=2
P32363	1.12e-07	173	365	146	341	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT14 PE=1 SV=4
O05083	1.17e-07	231	361	184	316	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002807_00631.