CAZyme Information: MGYG000002803_01015

Basic Information

• Species: CAG-196 sp900549855
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-196; CAG-196 sp900549855
• CAZyme ID: MGYG000002803_01015
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000002803_17|CGC1	42509.62	8.5109

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002803	2261140	MAG	Peru	South America

• Gene Location: Start: 20548; End: 21669 Strand: +

Full Sequence      

MKKIFIITGEYSGDVHAGCVAEILKQKNPEIEIEGIGSINLQNAGAKLFCDHSKMSGFGF
SLKMAIDHLLLEKKVSDYILNEYKPDLVLLIDYGTFNLRVAKRLKGHGIKVFHYIPPQVW
ASRKWRIKGIKKYVDEVLCIFPFEEDMYKEYGINVHYCGHPLIKQLPEKANREEFFARHG
LDTSRPLVSIFPGSRPLELKFLAKTFIKAAKTLQKKHPEVQFCISHAPNLSDGIFDKYIH
DTDFKVIKGENQALLSVSDSLILASGTVALEASLYQVPLLIGYKGPWILYLLYLLFRCIK
KVSLPNIVTGEDIVPELIQAKFNADNICYETERFLYDKEYREKTIAELGKVRAKLSDKYS
AQEVAEEIIKALN

Enzyme Prediction     

No EC number prediction in MGYG000002803_01015.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	2.1e-101	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.66e-115	1	370	1	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.47e-97	1	373	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.35e-73	4	364	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.71e-63	4	371	8	381	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.56e-39	1	342	1	330	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	8.65e-176	1	372	1	372
AEH45383.1	1.98e-72	3	366	10	370
AKQ33376.1	4.13e-71	2	372	6	376
AJQ25963.1	1.56e-69	1	369	1	372
QTS83715.1	2.44e-67	2	365	6	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	8.38e-39	4	319	9	329	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.62e-38	4	319	9	329	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8JE78	1.57e-66	3	369	10	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
Q74AT9	3.20e-66	3	372	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2IL69	4.39e-66	3	369	10	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B4UHR6	8.71e-66	3	369	10	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q1D393	1.23e-65	3	372	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002803_01015.