CAZyme Information: MGYG000002801_00070

Basic Information

• Species: Parolsenella sp900549525
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Parolsenella; Parolsenella sp900549525
• CAZyme ID: MGYG000002801_00070
• CAZy Family: CE7
• CAZyme Description: Cephalosporin-C deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000002801_2|CGC2	37791.8	4.2687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002801	1902228	MAG	Peru	South America

• Gene Location: Start: 22586; End: 23635 Strand: -

Full Sequence      

MPYTQAQIKALANYHGSVAVPDDFDEFWAARMAEADAVPLEWELVPAAEAMGGANISPEA
LAAASCSLYDLWFTGMDGARLHAKYLVPTGELALTQTPEGEPFFGVPLVLQFHGYPGTSR
SWLEQMSYVGMGMAVLAFDCPGQGGPGDDAGGYHGTTVAGHIVAGLDGDSAGLYYVRCHQ
DIRVLCRIVRELPDVDLSRVYVNGASQGGGLGIACAALNADLVSRAAILYPFLSDYKKVF
ELEADDIAYEGLRYYARWFDPAGIRTDEVFGKLAYIDSVSFAHLVRCEVLFGTGLADVVC
PPPTQCAVYNNLACPKRRVLFPDFGHEEIQAFDDMIIDFFNVGLGEGRE

Enzyme Prediction     

No EC number prediction in MGYG000002801_00070.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE7	5	340	9.2e-83	0.987220447284345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05448	AXE1	9.56e-81	11	332	10	305	Acetyl xylan esterase (AXE1). This family consists of several bacterial acetyl xylan esterase proteins. Acetyl xylan esterases are enzymes that hydrolyze the ester linkages of the acetyl groups in position 2 and/or 3 of the xylose moieties of natural acetylated xylan from hardwood. These enzymes are one of the accessory enzymes which are part of the xylanolytic system, together with xylanases, beta-xylosidases, alpha-arabinofuranosidases and methylglucuronidases; these are all required for the complete hydrolysis of xylan.
COG3458	Axe1	4.78e-80	1	344	1	317	Cephalosporin-C deacetylase or related acetyl esterase [Secondary metabolites biosynthesis, transport and catabolism].
COG1506	DAP2	1.24e-12	72	327	369	595	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0596	MhpC	8.88e-04	105	340	20	279	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].
COG2267	PldB	0.006	70	233	11	142	Lysophospholipase, alpha-beta hydrolase superfamily [Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU40725.1	1.30e-154	1	346	1	323
QQR06497.1	1.30e-154	1	346	1	323
ATP53212.1	1.48e-151	1	343	1	320
QIA32853.1	1.21e-150	1	343	1	320
AZH69971.1	6.95e-150	1	343	1	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FCY_A	2.00e-76	8	339	34	340	CrystalStructure of Acetyl Xylan Esterase 1 from Thermoanaerobacterium sp. JW/SL YS485 [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3FCY_B Crystal Structure of Acetyl Xylan Esterase 1 from Thermoanaerobacterium sp. JW/SL YS485 [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3FCY_C Crystal Structure of Acetyl Xylan Esterase 1 from Thermoanaerobacterium sp. JW/SL YS485 [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
7CUZ_A	2.57e-68	7	336	3	308	ChainA, Acetylxylan esterase [Lactococcus lactis subsp. lactis KF147],7CUZ_B Chain B, Acetylxylan esterase [Lactococcus lactis subsp. lactis KF147],7CUZ_C Chain C, Acetylxylan esterase [Lactococcus lactis subsp. lactis KF147],7CUZ_D Chain D, Acetylxylan esterase [Lactococcus lactis subsp. lactis KF147]
6AGQ_A	1.69e-46	1	344	1	321	Acetylxylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_B Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_C Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_D Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_E Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_F Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4]
1ODS_A	2.11e-31	8	344	8	316	CephalosporinC deacetylase from Bacillus subtilis [Bacillus subtilis],1ODS_B Cephalosporin C deacetylase from Bacillus subtilis [Bacillus subtilis],1ODS_C Cephalosporin C deacetylase from Bacillus subtilis [Bacillus subtilis],1ODS_D Cephalosporin C deacetylase from Bacillus subtilis [Bacillus subtilis],1ODS_E Cephalosporin C deacetylase from Bacillus subtilis [Bacillus subtilis],1ODS_F Cephalosporin C deacetylase from Bacillus subtilis [Bacillus subtilis],1ODS_G Cephalosporin C deacetylase from Bacillus subtilis [Bacillus subtilis],1ODS_H Cephalosporin C deacetylase from Bacillus subtilis [Bacillus subtilis]
1ODT_C	1.52e-30	8	344	8	316	cephalosporinC deacetylase mutated, in complex with acetate [Bacillus subtilis],1ODT_H cephalosporin C deacetylase mutated, in complex with acetate [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94388	5.99e-30	8	344	8	316	Cephalosporin-C deacetylase OS=Bacillus subtilis (strain 168) OX=224308 GN=cah PE=1 SV=1
Q9WXT2	9.28e-28	1	327	1	304	Cephalosporin-C deacetylase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=axeA PE=1 SV=1
D5EXI2	1.47e-14	21	322	143	416	Acetyl esterase Axe7A OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe7A PE=1 SV=1
Q32LS6	4.13e-07	70	328	88	300	Protein ABHD13 OS=Danio rerio OX=7955 GN=abhd13 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002801_00070.