CAZyme Information: MGYG000002786_00527

Basic Information

• Species: UMGS268 sp900540175
• Lineage: Bacteria; Firmicutes; Bacilli; Acholeplasmatales; Anaeroplasmataceae; UMGS268; UMGS268 sp900540175
• CAZyme ID: MGYG000002786_00527
• CAZy Family: PL9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1285	MGYG000002786_4|CGC1	140827.93	4.3029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002786	1606694	MAG	United States	North America

• Gene Location: Start: 74943; End: 78800 Strand: +

Full Sequence      

MFKKFVLVCSLFLLCAGLLTVASCKDETKGNDEVILTFVTNGGQELEAMKGKPGEALQLP
IPVFDGYSFAYWAKDELLENKFESSVFPEENMTLYAKWLANYRELTVVYHNGLPSLKKKV
IETTAVSLENPTLEGCRFAGWYTDEPLTLAFNGTMPKSDLTVYAKWEKEEDTAFVSPKGN
PQASGSWFDPLDFDTALARMKRGAQNQLHQLYLQSGTYEFSTRKIVDTDMSGTVDSYQII
AGVDGDSLPIFDYSQQEYGQRGFDIRADYVHLSNLIVERAGAYGIYVGGSHNIVENCVTR
YNRNTGLGIARWDDSQNTLDKYPSDNLILKCTSHDNFDYNNGGEDADGFSAKLTVGHNNI
FDSCIAFANSDDGWDLYSKSSSGNTGVTKIINCIAFRNGFLSDIGDENNTSSYNNGRTRD
GDGNGFKLGGEVMYTNAYLENCISFENGAHGYTDNSNPGILNLKNCTAYNNGLFEAGRYQ
NFNLARTTDSLNVYDGLLSIATSNYSQSCADEFRGPISNSLVLHTADQKLQYYAILDVIN
GNSRIEELSGMPVTVNAADVFEKTDVRAFYVQTVASADEVHKVLRNQDGSINLGSYLKIN
DGALQNLQLDFIGGRLAMDSWEEYRHHESLAIPQGATADTVVAYQIYNQLFVMCNEEAVY
EDLDLYKTILGHPIHWTSSHPDIVTVDLENPNPKDASKGTDTYYWGIVKNPSSDQQVTLT
ATISIGDVELQKEFKLLIKALKPMIGDIEITYPDVILQGEPFDPVMTVYDLNGRSDDQVI
SSENLVVTTRIFYEIYGQQIEIEELNTEIPGTYKIEYSVALKDSDQMKTETIVLDVVNIA
SPVEIEEVTALASGGASVRVKVNWATGKIFAIAVAKGSPAPTALDVITANDYQVGDISVE
VKDFTSSDISSLEFTIGFANAAYGDYTYYLVVQNENGLSEVASVDAVAPTYISTAQELYD
VLHRDVLNTEYIVLSNDIDLKDVTWDMAEVTFAGIFDGAGYTISNLTIQYDGVTYAGLFY
ETNGALIQNVTLKEVQIQADNSTGAAALIGKASATNVSNVKIRNVRVSGVESIGGLIGQT
SSGNVTLKQVSVINESSYLISASKRYAGGLVGCFMGGPSDDSYNEIIIENAEVVANVECG
KSGYVGGFVGRVKGNEARYLKIEKAVYEGTLTGKYAGTTTGGSDKNVLGCRMEFNHIVSF
AKIATDNKDNGVMNGRLQSNTIQGVTTTNTSWVELSSGANAKPKNVKADANQVVQEETLD
RAFYQAFDLTDCWSFNEETARITLK

Enzyme Prediction     

No EC number prediction in MGYG000002786_00527.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL9	169	602	4.7e-95	0.9813333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09479	Flg_new	4.32e-08	123	165	20	65	Listeria-Bacteroides repeat domain (List_Bact_rpt). This model describes a conserved core region of about 43 residues, which occurs in at least two families of tandem repeats. These include 78-residue repeats which occur from 2 to 15 times in some proteins of Bacteroides forsythus ATCC 43037, and 70-residue repeats found in families of internalins of Listeria species. Single copies are found in proteins of Fibrobacter succinogenes, Geobacter sulfurreducens, and a few other bacteria.
pfam13229	Beta_helix	5.62e-08	266	415	7	133	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam09479	Flg_new	3.00e-07	36	97	3	65	Listeria-Bacteroides repeat domain (List_Bact_rpt). This model describes a conserved core region of about 43 residues, which occurs in at least two families of tandem repeats. These include 78-residue repeats which occur from 2 to 15 times in some proteins of Bacteroides forsythus ATCC 43037, and 70-residue repeats found in families of internalins of Listeria species. Single copies are found in proteins of Fibrobacter succinogenes, Geobacter sulfurreducens, and a few other bacteria.
NF033188	internalin_H	6.36e-06	62	180	372	499	InlH/InlC2 family class 1 internalin. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin H (InlH), or internalin C2, two class 1 (LPXTG-type) internalins that are closely related, one apparently derived from the other through a recombination event.
NF033189	internalin_A	1.23e-04	57	168	588	704	class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX42257.1	1.70e-76	174	603	204	605
AAG59609.1	3.82e-70	174	599	410	810
ADZ82028.1	4.39e-70	172	599	317	717
QEH67746.1	1.70e-69	172	599	395	795
ADL51369.1	1.05e-68	174	599	834	1234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RU4_A	5.60e-31	174	473	18	294	ChainA, Pectate lyase [Dickeya chrysanthemi]
5OLQ_A	4.32e-09	249	507	91	359	Rhamnogalacturonanlyase [Bacteroides thetaiotaomicron],5OLQ_B Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLQ_C Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLR_A Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLR_B Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLR_C Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLS_A Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C1A7	4.69e-30	174	473	43	319	Pectate lyase L OS=Dickeya dadantii (strain 3937) OX=198628 GN=pelL PE=1 SV=1
P0C1A6	3.76e-29	174	473	43	319	Pectate lyase L OS=Dickeya chrysanthemi OX=556 GN=pelL PE=3 SV=1
P22751	6.37e-22	154	474	353	642	Pectate disaccharide-lyase OS=Dickeya chrysanthemi OX=556 GN=pelX PE=1 SV=1
Q18DN4	5.81e-08	992	1096	5558	5659	Halomucin OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) OX=362976 GN=hmu PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000068	0.999973	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	22